DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and Cerk

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_649530.2 Gene:Cerk FlyBaseID:FBgn0037315 Length:687 Species:Drosophila melanogaster

Alignment Length:664 Identity:153/665 (23%)
Similarity:257/665 (39%) Gaps:166/665 (25%)


  Fly    25 PTSDTEVASGTPTELSE--IFFVDNSRRKQSIKI-------------QVKLCPEGVYLRRETEED 74
            |.|.|..:..||...|:  :...:...:|:|.::             ::|..|:|...:.....|
  Fly    21 PISSTSASKFTPCSASDHNVLLNNFQLKKKSYRVLLHGQQLVWERLQKIKQSPQGNEAKAPLPPD 85

  Fly    75 DHI----------NEQLIRIDDIIGSRYGRRLKKRARGGLNSCRNPNVPGQEADSEPDSD----- 124
            ...          ...::.:||::..|.|   ..:|    :|.:.|:.||.|..|....|     
  Fly    86 SPAQPGGICSYGPQSHVLHLDDVVSIRSG---DTKA----SSLKPPSPPGSERSSGCSGDVAQGK 143

  Fly   125 -NSAYLYIYAYLKKEKPLRRVQT------LRILRFRSSNDYGVNLQTAEMWHHTIRKHKRGNGSS 182
             .|.||.|...::    |.:.||      ||.|.|.:|:.|.|.....|:   .||.|     ||
  Fly   144 PTSQYLTINYAMR----LSKSQTDCNRWELRRLTFFNSDPYIVRQWDQEL---QIRLH-----SS 196

  Fly   183 SPADCG-KQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDLLT 246
            ||.... ::||:.:||..|...|.:.:::.|.|:...|.|......|......|:.:.:..  |.
  Fly   197 SPTRMRVRRLLVFINPYGGRKAGAQTYERHVRPIFQLAGVDATCITTQRANQVKDILLSHD--LG 259

  Fly   247 RYSGIVVASGDGLFYEVLNGLMER------MDWRR----ACRELPLGIIPCGSGNGLAKSVAHHC 301
            .|..:....|||...||:|||:.|      :|.:|    ....||:|:||.||.:.:|.|:    
  Fly   260 VYDAVCCVGGDGTVAEVINGLIFRQMRELGLDEQRPPYIPRPALPVGVIPAGSTDTIAYSM---- 320

  Fly   302 NEPYEPKPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESERLRSIG 366
               :....:..|.:..:.|:...:||..|   :..:..:.:....:.:|.:.|:..:||..|.:|
  Fly   321 ---HGTADVRTAAIHVILGQHRGLDVCSV---SNGQSLLRFCASVLSYGYLGDVAAQSENYRWMG 379

  Fly   367 AQRFTLWAIKRLIGLRSYKGRVSYLLGKGKKEPPVEAARELPAESTAAGIRSSLPLNAGEFHDLP 431
            .:|:....:|..:..|.|...:..|     :||               .:..:.||     .|:|
  Fly   380 PRRYEYSGVKAFLNNRGYDAELRML-----EEP---------------DLLLTTPL-----EDIP 419

  Fly   432 EEEEGEAVLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSLGGPSMRSNRSRMSI------ 490
            :..:           ...||..||     .|...|..:|.::.|    |::..||.:.|      
  Fly   420 QSPD-----------SVCSLGESV-----PSVCYANCQRCSFAS----SIQEQRSSLFIQEESKE 464

  Fly   491 ---SQRIEAANAEFAE---------------RVPTGTIPPLQMPLLSSDGWICEDGDFVMVHAAY 537
               :|::|..::..|.               |:|||:|.  .|..|.:|.|....|:|.|:..|.
  Fly   465 AERNQQVETEDSHLAASEAALLRPRPRPGNLRLPTGSIS--SMRNLGNDQWKVVRGNFFMICGAN 527

  Fly   538 TTHLSSDVFFAPE-----SRLDDGLIYLVIIRRGVSRHQLLN---FMLNLNAGTHLPIGEDPFIK 594
            .|...:.   :|.     |.|.||.:.|::::    :..|||   |:|| .||....|...||::
  Fly   528 ITCACAR---SPNGISRYSHLGDGCLDLILVK----KTSLLNNVRFLLN-TAGRSGDIRNLPFVE 584

  Fly   595 VVPCRAFRIEPSSS 608
            |...|.||....|:
  Fly   585 VYRTREFRFRTFSA 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 107/463 (23%)
DAGK_cat 191..330 CDD:279163 38/149 (26%)
CerkNP_649530.2 PLN02204 157..658 CDD:215126 125/518 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108661635
eggNOG 1 0.900 E1_COG1597
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681139at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12358
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R653
54.970

Return to query results.
Submit another query.