DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and Cerk

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_663450.3 Gene:Cerk MGIID:2386052 Length:531 Species:Mus musculus

Alignment Length:581 Identity:139/582 (24%)
Similarity:216/582 (37%) Gaps:205/582 (35%)


  Fly   110 PNVPGQEADS---------EPDSDNSAYLYIYAYLKKEKP----LRRVQTLRILRFRSS--NDYG 159
            |:.||.:|.|         |...|...:.....:.|.|.|    :.||:.:|..|::.:  ..:.
Mouse    42 PSAPGADARSVLVSEIIAVEEKDDCEKHASSGRWHKMENPFAFTVHRVKRVRHHRWKWARVTFWS 106

  Fly   160 VNLQTAEMWHHTIRKHKRGNG-----SSSPADCGKQLLILLNPKSGSGKGRELFQKQVAPLLTEA 219
            .:.|...:|..|:|      |     :|.|    |.||:.:||..|.|:|:.:::|.||||.|.|
Mouse   107 ADEQLCHLWLQTLR------GLLESLTSRP----KHLLVFINPFGGKGQGKRIYEKTVAPLFTLA 161

  Fly   220 EVQYDLQITTHPQYAKEFVRTRRDLLT-RYSGIVVASGDGLFYEVLNGLMERM--------DWRR 275
            .:..::.||.|...|||   |..::.| .|.|||...|||:|.|||:|::.|.        :..|
Mouse   162 SITTEIIITEHANQAKE---TLYEINTDSYDGIVCVGGDGMFSEVLHGVIGRTQQSAGIDPNHPR 223

  Fly   276 AC---RELPLGIIPCGS---------GNGLAKSVAHHCNEPYEPKPILHATLTCMAGKSTPMDVV 328
            |.   ..|.:||||.||         |...|::.|.|                .:.|.|..:||.
Mouse   224 AVLVPSTLRIGIIPAGSTDCVCYSTVGTNDAETSALH----------------IIIGDSLAIDVS 272

  Fly   329 RVELATRDKHF----VMYSFLSVGWGLIADIDIESERLRSIGAQRFTLWAIKRLIGLRSYKGRVS 389
            .|       |:    :.||...:|:|...|:..:||:.|.:|..|:....:|..:..:.|:|.:|
Mouse   273 SV-------HYHNTLLRYSVSLLGYGFYGDLIKDSEKKRWMGLVRYDFSGLKTFLSHQYYEGTLS 330

  Fly   390 YLLGKGKKEPPVEAARELPAESTAAGIRSSLPLNAGEF------HDLPEEEEGEAVLDGEQFADA 448
            :                |||:.|....|.:.|..||.|      ..|.|||              
Mouse   331 F----------------LPAQHTVGSPRDNKPCRAGCFVCRQSKQQLEEEE-------------- 365

  Fly   449 ISLDRSVYRQHADSWHSAMSRRTAYYSLGGPSMRSNRSRMSISQRIEAANAEFAERVPTGTIPPL 513
                                 :.|.|.|                    .|||..|.         
Mouse   366 ---------------------KKALYGL--------------------ENAEEMEE--------- 380

  Fly   514 QMPLLSSDGWICEDGDFVMVHAAYTTHLS-----SDVFFAPESRLDDGLIYLVIIRRGVSRHQLL 573
                     |....|.|:.::|   |::|     |....:|.:.|.||...|::||: .||...|
Mouse   381 ---------WQVTCGKFLAINA---TNMSCACPRSPGGLSPFAHLGDGSSDLILIRK-CSRFNFL 432

  Fly   574 NFML-NLNAGTHLPIGED----PFIKVVPCRAF-----RIEPSSSDGILVVDGERVEYGPI 624
            .|:: :.|.       ||    .|::|...:.|     .:|...:|.   .:.|:.::|.|
Mouse   433 RFLIRHTNQ-------EDQFDFTFVEVYRVKKFHFTSKHVEDEDNDS---KEQEKQKFGKI 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 116/479 (24%)
DAGK_cat 191..330 CDD:279163 52/160 (33%)
CerkNP_663450.3 Required for binding to sulfatide and phosphoinositides. {ECO:0000250} 1..125 19/89 (21%)
PLN02204 84..528 CDD:215126 129/540 (24%)
Substrate binding. {ECO:0000250} 195..198 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108699986
eggNOG 1 0.900 E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R653
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.