DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and cerkl

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:XP_002932061.2 Gene:cerkl XenbaseID:XB-GENE-6035280 Length:643 Species:Xenopus tropicalis

Alignment Length:453 Identity:101/454 (22%)
Similarity:161/454 (35%) Gaps:141/454 (31%)


  Fly    15 NGGKTHEPSTPTSDTEVASGTPTE----------LSEIFFVDNSRRKQSIKIQV--------KLC 61
            :|.:.|..:...|..|..||..:.          |..||.::    |:|..:.:        .:.
 Frog   117 SGVRAHSDTDDRSFEESGSGRSSRDPGGGQPAILLRGIFHIE----KRSCDVSLTCNQLQWSPIQ 177

  Fly    62 PEGVYLRRETEEDDHINEQLIRIDDIIGSRYGRRLKKRARGGLNSCRNPNVPGQEADSEPDSDNS 126
            ||.......|.:.   .|:::.:.||    :..:||:|...|                  .:...
 Frog   178 PESPGSTSLTHQQ---KEEILDLRDI----FSVKLKRRRSAG------------------QTKGG 217

  Fly   127 AYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAEMWHHTIRKHKRGNGSSSPADCGKQL 191
            ..|.|..:|...|. |:::...:.....|.||      .::|...:::...|..:..     |.|
 Frog   218 TLLGITIFLCIRKG-RKLKDRSVHLHNQSEDY------CDIWFKQLKEILNGFPNRP-----KSL 270

  Fly   192 LILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDLLTRYSGIVVASG 256
            .|::||.|..|:..:|:.:.||||...|::|.|:..||:..:|...:|...  |..|.|:|...|
 Frog   271 KIIINPHSHKGEASKLYYEHVAPLFKLADIQTDVTETTYAGHALALLRECE--LQEYDGVVCVGG 333

  Fly   257 DGLFYEVLNGLMERMD----------WRRACRELPLGIIPCGSGNGLAKSVAHHCNEPYEPKPIL 311
            ||...||.:||:.|..          :......:||||||.||.|.||.|              |
 Frog   334 DGSANEVAHGLLLRAQIDAGKNTDTIFTPVRAPIPLGIIPAGSTNVLAYS--------------L 384

  Fly   312 HAT-------LTCMAGKSTPMDVVR--------------------VELATRDKHFVM-------Y 342
            |.|       |..:.|...|:|...                    ..||..:||..|       :
 Frog   385 HGTKHTGTAALHIIMGNIQPVDTCTFSSSNKLLRFGFSAMFGFGGATLALAEKHRWMPSSQRREF 449

  Fly   343 SFLSVGWGL------IADIDIESERLRSIGAQRFTLWAIKRLIGLRSYKGRVSYLLGKGKKEP 399
            :||.....|      :..:.|::|.::..|||:     .||....||           |.|:|
 Frog   450 AFLKTLANLKPESCELTFLPIKNEEVKYRGAQK-----NKREKAARS-----------GSKDP 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 70/262 (27%)
DAGK_cat 191..330 CDD:279163 49/176 (28%)
cerklXP_002932061.2 PLN02204 163..626 CDD:215126 90/404 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108584871
eggNOG 1 0.900 E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.