DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and sphk2

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:XP_021322621.1 Gene:sphk2 ZFINID:ZDB-GENE-100922-225 Length:869 Species:Danio rerio

Alignment Length:907 Identity:232/908 (26%)
Similarity:330/908 (36%) Gaps:353/908 (39%)


  Fly     5 TGTSGENLMGNGGKTHEPSTPTSDTEVASGTPTELSEIFFVDNSRRKQSIKIQVKLCPEGVYLRR 69
            :|::..:...:.|....||:|.|.....:.|||                                
Zfish    30 SGSNSNSCPNSPGGVSLPSSPASTNYALTLTPT-------------------------------- 62

  Fly    70 ETEEDDHINEQLIRIDDIIGSRYGRRLKKRAR-----GGLNSCRNPNVPGQEADSEPDSDNSAYL 129
                  ||:.|          |...|..|::|     ..|..|..|..|....         ..|
Zfish    63 ------HIHVQ----------RLSPRAGKQSRLLLPMAELTGCSCPRSPAPPL---------LVL 102

  Fly   130 YIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAEMWHHTIRKHKRGNGSSSPADCGK----- 189
            |.|...::.|.:.|.:.:|.....|..:       ||.|:..|:...||...||..:..|     
Zfish   103 YWYPPGRRRKGVSRHRQVRAYLAESRAE-------AEKWNAAIQSLLRGMDVSSTTEFCKSMLPR 160

  Fly   190 --QLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDLLTRYSGIV 252
              :||:|:||.||.|:..:..|..:.|::.||.:.|:|..|....:|:|.:  |...|..:.|||
Zfish   161 PRRLLLLVNPFSGRGQAMQWCQTHILPMIREANISYNLIQTERQNHARELI--REISLPEWDGIV 223

  Fly   253 VASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLAKSVAHHCNEPY---EPKPILHAT 314
            :.|||||.:||:||||||.||.:|.: .|:||:||||||.||.|:.||.....   ||..:....
Zfish   224 IVSGDGLLHEVINGLMERPDWEQAIK-TPVGILPCGSGNALAGSINHHAGYDMCLREPLLLNCCF 287

  Fly   315 LTCMAGKSTPMDVVRV--------ELATRDKH----FVMYSFLSVGWGLIADIDIESERLRSIGA 367
            |.|..|.. |:|:|.|        ..:.::.|    ..::|||||.||.::|:||||||.|.:|:
Zfish   288 LLCRGGVK-PLDLVSVTTSPCASSSTSNQNGHPPAPRRLFSFLSVAWGFVSDVDIESERYRGLGS 351

  Fly   368 QRFTLWAIKRLIGLRSYKGRVSYL----------------------------------------- 391
            .||||..:.||..|||||||:|||                                         
Zfish   352 ARFTLGTLVRLASLRSYKGRLSYLPPAVVNPSPDATPQPPRRPLSRSITEGLEGFCRTPIHRTCS 416

  Fly   392 ---------------------------------------LGKG---------KKEPPVEAAREL- 407
                                                   .|.|         .:|..|||..:: 
Zfish   417 DMGLSEQRSLRKDDGERERERERERQERERERERRRDRARGVGVVRASSLAEDREREVEAEEKME 481

  Fly   408 -----PAESTAAGIRSSLPLNAGEFHDLPEEE--EGEAVLDGEQFADAISL---------DRSVY 456
                 .:|||......::..|.|.     |||  .|::.:||::..:|.:|         |.| |
Zfish   482 EMSGTSSESTERDECDNIAKNNGN-----EEENNSGKSKIDGQELTNARNLSDTNEVNDCDGS-Y 540

  Fly   457 R------QHADSWHSAMSRR--------------------TAY----------------YSL--- 476
            :      |||...:||.|.:                    .||                |||   
Zfish   541 QTTPPELQHALRKNSAPSSQIINAFFSQPIGADTDQDLELAAYGKEDEDINGTYFQKEAYSLDKS 605

  Fly   477 ----------------------------------------------------------------G 477
                                                                            .
Zfish   606 RERALTISSSPFRQSPFKAFKPKTLDQNQNPSRPRPLSLLHQSHSNSLPPKFPSLSLSLSPTPPS 670

  Fly   478 GPSMRSNRSRM---------------SISQRIEAANAEFAERVPTG------------------T 509
            .||..|..|..               ||.....:.|.:.||  |.|                  .
Zfish   671 SPSCASPHSSYLAPRPNTPSSSSPSPSIHSPTPSFNFDLAE--PAGPLKNRPHMTSSINLPEDDL 733

  Fly   510 IPPLQMPLLSSDGWICEDGDFVMVHAAYTTHLSSDVFFAPESRLDDGLIYLVIIRRGVSRHQLLN 574
            :|||..||.:.| |:..:||||:|.|.|.:||.:|:..||::|.|||||:|..:|.|:||..||.
Zfish   734 LPPLDQPLPTRD-WVTIEGDFVLVLAIYQSHLGADLLAAPQARFDDGLIHLTFVRAGISRATLLR 797

  Fly   575 FMLNLNAGTHLPIGEDPFIKVVPCRAFRIEPSSSDGILVVDGERVEYGPIQAEVMPGLINVM 636
            ..|.:..|.||.: ..|::..|..||||::|.|..|.|.||||.|.|||:||:|.|.:..::
Zfish   798 LFLAMERGAHLSL-SSPYVSHVSARAFRLQPLSPRGTLTVDGELVPYGPLQAQVHPSMARLI 858

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 191/703 (27%)
DAGK_cat 191..330 CDD:279163 60/142 (42%)
sphk2XP_021322621.1 LCB5 <168..>376 CDD:332482 91/212 (43%)
LCB5 <745..844 CDD:332482 47/101 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108627004
eggNOG 1 0.900 E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32456
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D561206at33208
OrthoFinder 1 1.000 FOG0001202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12358
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.