DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sk1 and cerkl

Sequence 1:NP_572717.1 Gene:Sk1 FlyBaseID:FBgn0030300 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001082943.1 Gene:cerkl ZFINID:ZDB-GENE-070410-38 Length:577 Species:Danio rerio

Alignment Length:602 Identity:136/603 (23%)
Similarity:221/603 (37%) Gaps:175/603 (29%)


  Fly    49 RRKQSIKIQV---KLCPEGVYLRR-ETE--EDDHINEQLIRIDDIIGSRYGRRLKKRARGGLNSC 107
            ::|||.|..|   :||||..|..| ||:  .|:.|...:.:|:           ||.....|.:.
Zfish    45 KQKQSQKRSVSAPQLCPEEDYKERVETKYRPDEPIVRGIFQIE-----------KKSHDVVLTTT 98

  Fly   108 RNPNVPGQEADSEPDSDNSAYLYIYAYLKKEK---PLRRVQTLRILRFRSS-------------- 155
            |....|.|......|.|          |||::   .|:.|..:::.|.||:              
Zfish    99 RVTWTPIQPETPTADRD----------LKKQEEYVDLKDVFAVKVKRRRSAGQQSGGTLLGITLF 153

  Fly   156 ---------NDYGVNLQT-----AEMWHHTIRKHKRGNGSSSPADCGKQLLILLNPKSGSGKGRE 206
                     .|:.::|..     .|:|..|:::...| ..:.|    |.|.:.:||.|...:..:
Zfish   154 QCKKKGLKLKDHAIHLNNLSVDHCEIWFKTLKELLNG-FKNRP----KSLKVFVNPISHKKEAYQ 213

  Fly   207 LFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDLLTRYSGIVVASGDGLFYEVLNGLMER- 270
            ::..:||||...|::|.|:.||....:|...::...  |..|.|:|...|||...||.:||:.| 
Zfish   214 IYLDEVAPLFKLADIQVDVTITERKGHALSILKDCS--LEDYDGVVCVGGDGSVSEVAHGLLLRA 276

  Fly   271 -MDWRRACRE-----------LPLGIIPCGSGNGLAKSVAHHCNEPYEPKPILHATLTCMAGKST 323
             ||   |.|:           ||||:||.||.:.:|.||       :..:....|.|..:.|...
Zfish   277 QMD---AGRDTDSIFTPVQAALPLGVIPAGSTDVVACSV-------HGIRRAATAALHIIMGHHQ 331

  Fly   324 PMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESERLRSI-GAQRFTLWAIKRLIGLRSYKGR 387
            |:||.......|...|...:....|...:|    .:||.|.: .:||.....||.|..|:.....
Zfish   332 PVDVCSFSCMGRLLRFGFSAMFGFGGRTLA----LAERHRWMPPSQRREFALIKTLAKLKPEDCE 392

  Fly   388 VSYLLGKGKKEPPVEAARELPAES-----------------------------TAAGIRSSLPLN 423
            :|:|..||.::   :...||..:.                             ...|:..:..||
Zfish   393 LSFLTAKGAED---QKKAELNGDGGDICEGDWQSRKGLFLNISIMAIPCLCSMAPRGLAPNTRLN 454

  Fly   424 AGEFHDLPEEEEGEAVLDGEQFADAISLDRSVYRQHADSWHSAMSRRTAYYSLGGPSMRSNRSRM 488
            .|..                ......:..||.:.:|...::|. :.:..:..:...|:::.|.|.
Zfish   455 NGSM----------------ALISVGNTSRSEFIKHLKRYNST-NNQFGFSFIETHSVKAVRLRP 502

  Fly   489 S--------ISQRIEAANAEFAERVPTGTIPPLQMPLLSSDG---WICEDGD--------FVMVH 534
            |        :|:..|.::::             ..|::||:|   |.. |||        .:.||
Zfish   503 SSQSSWTDDVSEENEESDSK-------------NTPIISSEGTYPWNI-DGDLLDVPSELLIRVH 553

  Fly   535 AAYTTHLSSDVFFAPES 551
            ....|...|||..|.|:
Zfish   554 PQLLTLFGSDVEEAEET 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sk1NP_572717.1 PLN02958 <189..622 CDD:215517 97/426 (23%)
DAGK_cat 191..330 CDD:279163 47/152 (31%)
cerklNP_001082943.1 PLN02204 92..565 CDD:215126 116/538 (22%)
LCB5 196..561 CDD:224513 92/415 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108561460
eggNOG 1 0.900 E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D681139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.