DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or10a and Or7a

DIOPT Version :8

Sequence 1:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster

Alignment Length:258 Identity:51/259 (20%)
Similarity:106/259 (41%) Gaps:47/259 (18%)


  Fly   190 FFPLTYIFIAYTGYVTIFMFGG-------------------CDGFYFEF------CAHLSA---- 225
            |:.:.|...:.:.:|..|:.|.                   |...:.||      |.|.::    
  Fly   147 FYQICYAIYSSSTFVCAFLLGQPPYALYLPGLDWQRSQMQFCIQAWIEFLIMNWTCLHQASDDVY 211

  Fly   226 ---LFEVLQAEIESMFRPY----TDHLELSPVQLYILEQK-------MRSVIIRHNAIIDLTRFF 276
               ...|::.:::.:.|..    ||  :...|::|..|::       ::..|:.|..::.|....
  Fly   212 AVIYLYVVRIQVQLLARRVEKLGTD--DSGQVEIYPDERRQEEHCAELQRCIVDHQTMLQLLDCI 274

  Fly   277 RDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESST 341
            ....:......|:..|.::|.:|:|:....|... .:..:.|.:|...|....||..|.:...:.
  Fly   275 SPVISRTIFVQFLITAAIMGTTMINIFIFANTNT-KIASIIYLLAVTLQTAPCCYQATSLMLDNE 338

  Fly   342 GLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVK 403
            .|..|:|.|.|.....:.|:::...:.|:|:|::: |:..|..:|||:.:|.:.|.|:..|:|
  Fly   339 RLALAIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLIK 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 48/250 (19%)
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 48/250 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51534
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.