powered by:
Protein Alignment Tim8 and TIM8
DIOPT Version :9
| Sequence 1: | NP_001285120.1 |
Gene: | Tim8 / 32081 |
FlyBaseID: | FBgn0027359 |
Length: | 88 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_058168.1 |
Gene: | TIM8 / 853600 |
SGDID: | S000007348 |
Length: | 87 |
Species: | Saccharomyces cerevisiae |
| Alignment Length: | 73 |
Identity: | 30/73 - (41%) |
| Similarity: | 44/73 - (60%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 SDFENLSG-NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPS-TKLDHATETCLSNCVDR 64
||..:|.. :.||:..||..|..|.:|...||:|..||::||:...: :.|....|.||||||:|
Yeast 7 SDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNR 71
Fly 65 FIDTSLLI 72
|:||::.|
Yeast 72 FLDTNIRI 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I2816 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3489 |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I1796 |
| Isobase |
1 |
0.950 |
- |
0.928771 |
Normalized mean entropy |
S910 |
| OMA |
1 |
1.010 |
- |
- |
|
QHG52653 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001713 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto99252 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101956 |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR19338 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1523 |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X1262 |
| TreeFam |
1 |
0.960 |
- |
- |
|
|
|
14 | 13.810 |
|
Return to query results.
Submit another query.