DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and TIM8

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_058168.1 Gene:TIM8 / 853600 SGDID:S000007348 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:30/73 - (41%)
Similarity:44/73 - (60%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDFENLSG-NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPS-TKLDHATETCLSNCVDR 64
            ||..:|.. :.||:..||..|..|.:|...||:|..||::||:...: :.|....|.||||||:|
Yeast     7 SDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNR 71

  Fly    65 FIDTSLLI 72
            |:||::.|
Yeast    72 FLDTNIRI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 25/58 (43%)
TIM8NP_058168.1 zf-Tim10_DDP 23..83 CDD:397210 25/57 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I2816
eggNOG 1 0.900 - - E1_KOG3489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I1796
Isobase 1 0.950 - 0.928771 Normalized mean entropy S910
OMA 1 1.010 - - QHG52653
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 1 1.000 - - oto99252
orthoMCL 1 0.900 - - OOG6_101956
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1523
SonicParanoid 1 1.000 - - X1262
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.