DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and TIM8

DIOPT Version :10

Sequence 1:NP_572713.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_058168.1 Gene:TIM8 / 853600 SGDID:S000007348 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:30/73 - (41%)
Similarity:44/73 - (60%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDFENLSG-NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPS-TKLDHATETCLSNCVDR 64
            ||..:|.. :.||:..||..|..|.:|...||:|..||::||:...: :.|....|.||||||:|
Yeast     7 SDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNR 71

  Fly    65 FIDTSLLI 72
            |:||::.|
Yeast    72 FLDTNIRI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_572713.1 zf-Tim10_DDP 16..78 CDD:460764 25/58 (43%)
TIM8NP_058168.1 zf-Tim10_DDP 23..85 CDD:460764 25/57 (44%)

Return to query results.
Submit another query.