DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and TIM8

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_058168.1 Gene:TIM8 SGDID:S000007348 Length:87 Species:Saccharomyces cerevisiae

Alignment Length:73 Identity:30/74 (41%)
Similarity:44/74 (59%) Gaps:2/74 (3%)


  Fly     2 SDFENLSG-NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPS-TKLDHATETCLSNCVDR 64
            ||..:|.. :.||:..||..|..|.:|...||:|..||::||:...: :.|....|.||||||:|
Yeast     7 SDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNR 71

  Fly    65 FIDTSLLI 72
            |:||::.|
Yeast    72 FLDTNIRI 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 25/59 (42%)
TIM8NP_058168.1 zf-Tim10_DDP 23..83 CDD:308549 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I1771
Isobase 1 0.950 0.928771 Normalized mean entropy S910
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 1 1.000 T1136997
orthoMCL 1 0.900 OOG5_128624
Panther 1 1.100 O PTHR19338
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1523
TreeFam 1 0.960
1211.810

Return to query results.
Submit another query.