DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and Timm8a1

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_445822.1 Gene:Timm8a1 RGDID:621801 Length:97 Species:Rattus norvegicus

Alignment Length:72 Identity:34/73 (47%)
Similarity:44/73 (60%) Gaps:0/73 (0%)


  Fly     7 LSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLL 71
            |:..|.:||.|:.:|.||.:....:|:..|:|||||:.||..|||...|.|..|||:||||||..
  Rat    12 LAAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQF 76

  Fly    72 ITQRFAQ 78
            |..|..|
  Rat    77 ILNRLEQ 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 29/60 (48%)
Timm8a1NP_445822.1 zf-Tim10_DDP 21..81 CDD:281019 29/60 (48%)
Twin CX3C motif 43..66 13/23 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.714 Consistency score
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.