DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and TIM8

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_199894.1 Gene:TIM8 AraportID:AT5G50810 Length:77 Species:Arabidopsis thaliana

Alignment Length:68 Identity:26/69 (38%)
Similarity:44/69 (64%) Gaps:1/69 (1%)


  Fly    10 NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCI-GKPSTKLDHATETCLSNCVDRFIDTSLLIT 73
            |:.||.:||..||::|.||..:.:...:||:||| ..|.:|...:..:||::|..|::|.|::|.
plant     7 NNPELLQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMIIM 71

  Fly    74 QRF 76
            :||
plant    72 KRF 74

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 22/61 (36%)
TIM8NP_199894.1 zf-Tim10_DDP 13..74 CDD:281019 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2455
OMA 1 1.010
OrthoDB 1 1.010 D1593287at2759
OrthoInspector 1 1.000 T192729
orthoMCL 1 0.900 OOG5_128624
Panther 1 1.100 O PTHR19338
Phylome 1 0.910 0.800 Consistency score
76.980

Return to query results.
Submit another query.