DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and TIM9

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_190240.1 Gene:TIM9 AraportID:AT3G46560 Length:93 Species:Arabidopsis thaliana

Alignment Length:85 Identity:20/86 (23%)
Similarity:40/86 (47%) Gaps:7/86 (8%)


  Fly     1 MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFN---EICWEKCIGKPSTK-LDHATETCLSNC 61
            |:..:.|...||.....::   .:.|:...:..:|   |.|:..|:...:.| |....|||:..|
plant     6 MAGLDGLPEEDKAKMASMI---DQLQLRDSLRMYNSLVERCFVDCVDSFTRKSLQKQEETCVMRC 67

  Fly    62 VDRFIDTSLLITQRFAQMLQ 81
            .::|:..::.:..|||::.|
plant    68 AEKFLKHTMRVGMRFAELNQ 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 13/64 (20%)
TIM9NP_190240.1 zf-Tim10_DDP 26..82 CDD:281019 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.