DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and timm8b

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001122251.1 Gene:timm8b ZFINID:ZDB-GENE-031019-1 Length:95 Species:Danio rerio

Alignment Length:92 Identity:48/93 (52%)
Similarity:64/93 (69%) Gaps:10/93 (11%)


  Fly     1 MSDFE------NLSGNDK----ELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATE 55
            |:||.      :...::|    |||..|.:|:||||..||:|.|.::||:||:.|||:|||..||
Zfish     1 MADFHSSFDLPSAGSSEKAEAAELQRMLAVEQQKAQFQAQVHNFTDVCWDKCVDKPSSKLDSRTE 65

  Fly    56 TCLSNCVDRFIDTSLLITQRFAQMLQK 82
            |||.:||:|||||:|.||.||.||:||
Zfish    66 TCLVSCVERFIDTTLTITNRFTQMVQK 92

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 36/60 (60%)
timm8bNP_001122251.1 zf-Tim10_DDP 26..86 CDD:281019 36/60 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190385644
eggNOG 1 0.900 E1_KOG3489
Hieranoid 1 1.000
Homologene 1 1.000 H8262
Inparanoid 1 1.050 103 1.000 Inparanoid score I4871
OMA 1 1.010
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 1 1.000 T1054846
orthoMCL 1 0.900 OOG5_128624
Panther 1 1.100 LDO PTHR19338
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1523
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.