DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and CG42302

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster


Alignment Length:72 Identity:20/72 - (27%)
Similarity:38/72 - (52%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSGNDKELQEFLLIEKQKAQVNAQ--IHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTS 69
            ::.|..:|:.   |.:|....|.|  |.:....|::.||..|..:|......||:||:|||:|:.
  Fly     1 MATNQHDLER---IRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDCLANCMDRFMDSV 62

  Fly    70 LLITQRF 76
            .:::.::
  Fly    63 QVVSSQY 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 18/61 (30%)
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:281019 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19338
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.