DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and Timm8a2

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001102899.1 Gene:Timm8a2 RGDID:1588172 Length:97 Species:Rattus norvegicus

Alignment Length:78 Identity:38/79 (48%)
Similarity:47/79 (59%) Gaps:4/79 (5%)


  Fly     2 SDFENLSGN----DKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCV 62
            |.:.:|.|:    |.:||.|:..|.||.:|...||...|:|||||:.||..|||...|.||.|||
  Rat     3 SSWSSLGGSLGSADPQLQRFMEAEVQKQRVQLLIHHMTELCWEKCMDKPGPKLDSRAELCLVNCV 67

  Fly    63 DRFIDTSLLITQR 75
            :||||||..|..|
  Rat    68 ERFIDTSQFILNR 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 32/61 (52%)
Timm8a2NP_001102899.1 zf-Tim10_DDP 21..81 CDD:281019 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128624
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.704 Consistency score
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.