DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and timm8b

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001017099.1 Gene:timm8b XenbaseID:XB-GENE-1010040 Length:94 Species:Xenopus tropicalis

Alignment Length:91 Identity:47/92 (51%)
Similarity:63/92 (68%) Gaps:9/92 (10%)


  Fly     1 MSDFE---NLSGND------KELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATET 56
            ||||:   :|||..      .|||..:.:|:||||..||:|.|.::||:||:.:|..|||..||.
 Frog     1 MSDFDSNLDLSGTGASPAEAAELQRMIAVEQQKAQFTAQVHNFMDVCWDKCMDRPGNKLDSRTEN 65

  Fly    57 CLSNCVDRFIDTSLLITQRFAQMLQK 82
            ||.:||||||||:|.:|.||||::||
 Frog    66 CLVSCVDRFIDTTLSVTNRFAQIVQK 91

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 32/60 (53%)
timm8bNP_001017099.1 zf-Tim10_DDP 25..85 CDD:281019 32/60 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190386094
eggNOG 1 0.900 E1_KOG3489
Hieranoid 1 1.000
Homologene 1 1.000 H8262
Inparanoid 1 1.050 99 1.000 Inparanoid score I4762
OMA 1 1.010
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 1 1.000 T1061657
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1523
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.