DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and timm8a

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001003637.1 Gene:timm8a ZFINID:ZDB-GENE-040801-158 Length:90 Species:Danio rerio

Alignment Length:74 Identity:37/75 (49%)
Similarity:47/75 (63%) Gaps:0/75 (0%)


  Fly    11 DKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQR 75
            |.:||:|:.||.||.:....:|:..|:|||||:.||..|||..||.|..|||:||||||..|..|
Zfish     9 DPQLQQFIEIESQKQRFQQLVHQMTEVCWEKCMDKPGPKLDSRTEVCFVNCVERFIDTSQFILNR 73

  Fly    76 FAQMLQKRG 84
            ..|..:.||
Zfish    74 LEQTQRSRG 82

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 31/60 (52%)
timm8aNP_001003637.1 zf-Tim10_DDP 14..74 CDD:281019 31/60 (52%)
Twin CX3C motif 36..59 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128624
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.704 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1523
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.