powered by:
Protein Alignment Tim8 and CG34132
DIOPT Version :9
| Sequence 1: | NP_001285120.1 |
Gene: | Tim8 / 32081 |
FlyBaseID: | FBgn0027359 |
Length: | 88 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001036344.1 |
Gene: | CG34132 / 4379884 |
FlyBaseID: | FBgn0083968 |
Length: | 84 |
Species: | Drosophila melanogaster |
| Alignment Length: | 65 |
Identity: | 25/65 - (38%) |
| Similarity: | 44/65 - (67%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 20 IEKQKAQVNAQ--IHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQRFAQMLQK 82
:::|.|..||| :.:..|.|::||:.||.|.||.:.:.|:|.|:|||:|:..||::.:.|.:|:
Fly 15 VKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSSEQKCISMCMDRFMDSWNLISRVYGQRIQR 79
Fly 83 82
Fly 80 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR19338 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.