DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and Tim13

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_648505.1 Gene:Tim13 FlyBaseID:FBgn0036204 Length:92 Species:Drosophila melanogaster

Alignment Length:65 Identity:24/66 (36%)
Similarity:40/66 (61%) Gaps:2/66 (3%)


  Fly    20 IEKQKAQVNAQ--IHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQRFAQMLQK 82
            :::|.|..|||  :.:..|.|::|||.||...||...:.|:|.|:|||:|...|:::.:...||:
  Fly    15 VKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDSTEQRCISQCMDRFMDAWNLVSRTYGNRLQR 79

  Fly    83  82
              Fly    80  79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 22/58 (38%)
Tim13NP_648505.1 zf-Tim10_DDP 13..73 CDD:281019 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19338
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.