powered by:
Protein Alignment Tim8 and Timm8a1
DIOPT Version :9
Sequence 1: | NP_001285120.1 |
Gene: | Tim8 / 32081 |
FlyBaseID: | FBgn0027359 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_038926.1 |
Gene: | Timm8a1 / 30058 |
MGIID: | 1353433 |
Length: | 97 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 34/72 - (47%) |
Similarity: | 43/72 - (59%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLL 71
|...|.:||.|:.:|.||.:....:|:..|:|||||:.||..|||...|.|..|||:||||||..
Mouse 12 LGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQF 76
Fly 72 ITQRFAQ 78
|..|..|
Mouse 77 ILNRLEQ 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.928771 |
Normalized mean entropy |
S910 |
OMA |
1 |
1.010 |
- |
- |
|
QHG52653 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1593287at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001713 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101956 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1523 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1262 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.710 |
|
Return to query results.
Submit another query.