powered by:
Protein Alignment Tim8 and TIMM8B
DIOPT Version :9
| Sequence 1: | NP_001285120.1 |
Gene: | Tim8 / 32081 |
FlyBaseID: | FBgn0027359 |
Length: | 88 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_036591.3 |
Gene: | TIMM8B / 26521 |
HGNCID: | 11818 |
Length: | 83 |
Species: | Homo sapiens |
| Alignment Length: | 75 |
Identity: | 44/75 - (58%) |
| Similarity: | 57/75 - (76%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQ 74
::.|||..:..|:||||..||:|.|.|:||:||:.||..:||..||.|||:||||||||:|.||.
Human 8 DEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITS 72
Fly 75 RFAQMLQKRG 84
||||::||.|
Human 73 RFAQIVQKGG 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C165157881 |
| Domainoid |
1 |
1.000 |
87 |
1.000 |
Domainoid score |
I8023 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
1 |
1.000 |
- |
- |
|
H8262 |
| Inparanoid |
1 |
1.050 |
101 |
1.000 |
Inparanoid score |
I4991 |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
1 |
1.010 |
- |
- |
|
QHG52653 |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1593287at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001713 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto89096 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101956 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR19338 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1523 |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X1262 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
13 | 12.940 |
|
Return to query results.
Submit another query.