DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and TIMM8B

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_036591.3 Gene:TIMM8B / 26521 HGNCID:11818 Length:83 Species:Homo sapiens


Alignment Length:75 Identity:44/75 - (58%)
Similarity:57/75 - (76%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQ 74
            ::.|||..:..|:||||..||:|.|.|:||:||:.||..:||..||.|||:||||||||:|.||.
Human     8 DEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITS 72

  Fly    75 RFAQMLQKRG 84
            ||||::||.|
Human    73 RFAQIVQKGG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 34/59 (58%)
TIMM8BNP_036591.3 zf-Tim10_DDP 16..74 CDD:397210 34/57 (60%)
Twin CX3C motif 36..59 13/22 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157881
Domainoid 1 1.000 87 1.000 Domainoid score I8023
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8262
Inparanoid 1 1.050 101 1.000 Inparanoid score I4991
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52653
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 1 1.000 - - oto89096
orthoMCL 1 0.900 - - OOG6_101956
Panther 1 1.100 - - LDO PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1523
SonicParanoid 1 1.000 - - X1262
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.