DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and TIMM8B

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_036591.3 Gene:TIMM8B HGNCID:11818 Length:83 Species:Homo sapiens

Alignment Length:75 Identity:44/76 (58%)
Similarity:57/76 (75%) Gaps:0/76 (0%)


  Fly    10 NDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQ 74
            ::.|||..:..|:||||..||:|.|.|:||:||:.||..:||..||.|||:||||||||:|.||.
Human     8 DEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITS 72

  Fly    75 RFAQMLQKRG 84
            ||||::||.|
Human    73 RFAQIVQKGG 82

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 35/60 (58%)
TIMM8BNP_036591.3 zf-Tim10_DDP 16..74 CDD:335168 35/58 (60%)
Twin CX3C motif 36..59 13/23 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190385437
eggNOG 1 0.900 E1_KOG3489
Hieranoid 1 1.000
Homologene 1 1.000 H8262
Inparanoid 1 1.050 100 1.000 Inparanoid score I4918
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 1 1.000 T1075623
orthoMCL 1 0.900 OOG5_128624
Panther 1 1.100 LDO PTHR19338
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1523
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.