DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and tim8

DIOPT Version :10

Sequence 1:NP_572713.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_592830.2 Gene:tim8 / 2542819 PomBaseID:SPAC13G6.04 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:31/72 - (43%)
Similarity:43/72 - (59%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRF 65
            :|:.|.|     ||.:|:..|:||.::...||:|...||.||||....|||.:.|.||.|||:||
pombe    12 LSESEQL-----ELSKFIESEQQKVKLQQAIHQFTSTCWPKCIGNIGNKLDKSEEQCLQNCVERF 71

  Fly    66 IDTSLLI 72
            :|.:..|
pombe    72 LDCNFHI 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_572713.1 zf-Tim10_DDP 16..78 CDD:460764 26/57 (46%)
tim8NP_592830.2 zf-Tim10_DDP 22..84 CDD:460764 26/57 (46%)

Return to query results.
Submit another query.