DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and tim8

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_592830.2 Gene:tim8 / 2542819 PomBaseID:SPAC13G6.04 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:31/72 - (43%)
Similarity:43/72 - (59%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRF 65
            :|:.|.|     ||.:|:..|:||.::...||:|...||.||||....|||.:.|.||.|||:||
pombe    12 LSESEQL-----ELSKFIESEQQKVKLQQAIHQFTSTCWPKCIGNIGNKLDKSEEQCLQNCVERF 71

  Fly    66 IDTSLLI 72
            :|.:..|
pombe    72 LDCNFHI 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 26/57 (46%)
tim8NP_592830.2 zf-Tim10_DDP 22..82 CDD:281019 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2770
eggNOG 1 0.900 - - E1_KOG3489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I1924
OMA 1 1.010 - - QHG52653
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 1 1.000 - - oto100814
orthoMCL 1 0.900 - - OOG6_101956
Panther 1 1.100 - - O PTHR19338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1523
SonicParanoid 1 1.000 - - X1262
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.