DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and tim8

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_592830.2 Gene:tim8 PomBaseID:SPAC13G6.04 Length:87 Species:Schizosaccharomyces pombe

Alignment Length:72 Identity:31/73 (42%)
Similarity:43/73 (59%) Gaps:5/73 (7%)


  Fly     1 MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRF 65
            :|:.|.|     ||.:|:..|:||.::...||:|...||.||||....|||.:.|.||.|||:||
pombe    12 LSESEQL-----ELSKFIESEQQKVKLQQAIHQFTSTCWPKCIGNIGNKLDKSEEQCLQNCVERF 71

  Fly    66 IDTSLLI 72
            :|.:..|
pombe    72 LDCNFHI 78

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 26/58 (45%)
tim8NP_592830.2 zf-Tim10_DDP 22..82 CDD:281019 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I1898
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 1 1.000 T1126023
orthoMCL 1 0.900 OOG5_128624
Panther 1 1.100 O PTHR19338
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1523
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.