DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and ddp-1

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_497467.1 Gene:ddp-1 WormBaseID:WBGene00000941 Length:83 Species:Caenorhabditis elegans

Alignment Length:81 Identity:28/82 (34%)
Similarity:41/82 (50%) Gaps:9/82 (11%)


  Fly    11 DKELQEF---LLIEKQKAQVNAQIHEFNEICWEKCIG--KPSTKLDHATETCLSNCVDRFIDTSL 70
            |.:|..|   |..|.|:.:...|:|.....||:.|..  :|.:|:|..|:||:.|||:|.||.|.
 Worm     5 DPQLNRFLQQLQAETQRQKFTEQVHTLTGRCWDVCFADYRPPSKMDGKTQTCIQNCVNRMIDASN 69

  Fly    71 LITQRFAQMLQKRGGG 86
            .:.:.    |.|..||
 Worm    70 FMVEH----LSKMNGG 81

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 22/65 (34%)
ddp-1NP_497467.1 zf-Tim10_DDP 13..75 CDD:281019 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4037
Isobase 1 0.950 0.928771 Normalized mean entropy S910
OMA 1 1.010
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 1 1.000 T474293
orthoMCL 1 0.900 OOG5_128624
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.947 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1523
TreeFam 1 0.960
1110.720

Return to query results.
Submit another query.