DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim8 and TIMM8A

DIOPT Version :9

Sequence 1:NP_001285120.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_004076.1 Gene:TIMM8A / 1678 HGNCID:11817 Length:97 Species:Homo sapiens


Alignment Length:77 Identity:35/77 - (45%)
Similarity:44/77 - (57%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFI 66
            |....|...|.:||.|:.:|.||.:....:|:..|:|||||:.||..|||...|.|..|||:|||
Human     7 SSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFI 71

  Fly    67 DTSLLITQRFAQ 78
            |||..|..|..|
Human    72 DTSQFILNRLEQ 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:397210 28/59 (47%)
TIMM8ANP_004076.1 zf-Tim10_DDP 21..81 CDD:397210 28/59 (47%)
Twin CX3C motif 43..66 12/22 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S910
OMA 1 1.010 - - QHG52653
OrthoDB 1 1.010 - - D1593287at2759
OrthoFinder 1 1.000 - - FOG0001713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101956
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1523
SonicParanoid 1 1.000 - - X1262
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.