DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim8 and timm8a

Sequence 1:NP_001285120.1 Gene:Tim8 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_002940448.1 Gene:timm8a XenbaseID:XB-GENE-969317 Length:87 Species:Xenopus tropicalis

Alignment Length:73 Identity:34/74 (46%)
Similarity:44/74 (59%) Gaps:0/74 (0%)


  Fly    11 DKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTSLLITQR 75
            |.|||.|:..|.||.:....:|:..|:|||||:.||..|:|..:|.|..|||:||||||..|..|
 Frog     6 DPELQRFIEAETQKQRFQTLVHQLTELCWEKCMEKPGPKMDARSEGCFVNCVERFIDTSQFILNR 70

  Fly    76 FAQMLQKR 83
            ..|..:.|
 Frog    71 LEQTQKSR 78

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim8NP_001285120.1 zf-Tim10_DDP 16..76 CDD:281019 28/60 (47%)
timm8aXP_002940448.1 zf-Tim10_DDP 11..71 CDD:281019 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1593287at2759
OrthoFinder 1 1.000 FOG0001338
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.