DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsh and DVL2

DIOPT Version :10

Sequence 1:NP_511118.2 Gene:dsh / 32078 FlyBaseID:FBgn0000499 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_004413.1 Gene:DVL2 / 1856 HGNCID:3086 Length:736 Species:Homo sapiens


Alignment Length:152 Identity:28/152 - (18%)
Similarity:50/152 - (32%) Gaps:54/152 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LDDENESSAH---YLRSQWTVCVKSAKILKKVTVVMRSAERVDRVFGSAWL-------------- 59
            |::..:|..|   ||..:.....:..|:|::..|:.....|      :|:|              
Human  1769 LNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRR------AAYLNMTQDPNHPAMALN 1827

  Fly    60 ----------KSEKYMTKVNATDINVPKGAVLH--------------------PHFYHFNPPITN 94
                      :|.::::|.:... |.|..||||                    |......||:..
Human  1828 ARLAEVECLAESHQHLSKESLAG-NKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAA 1891

  Fly    95 IGKYSAQLIGRALRNRGIEPGV 116
            ..:.|.:.|...|.||..:|.:
Human  1892 RLQMSERSILSRLTNRAGDPTI 1913

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dshNP_511118.2 DAX 8..91 CDD:197474 20/125 (16%)
Dishevelled <174..248 CDD:460544
PDZ_Dishevelled-like 252..338 CDD:467201
DEP_dishevelled 395..478 CDD:239885
DVL2NP_004413.1 DAX 13..93 CDD:197474
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..254
Dishevelled 125..263 CDD:460544
Required for interaction with FOXK2. /evidence=ECO:0000269|PubMed:25805136 250..355
PDZ_Dishevelled-like 267..353 CDD:467201
DEP_dishevelled 424..507 CDD:239885
Dsh_C 515..726 CDD:463531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 558..675
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.