DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsh and DVL1

DIOPT Version :10

Sequence 1:NP_511118.2 Gene:dsh / 32078 FlyBaseID:FBgn0000499 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001317240.1 Gene:DVL1 / 1855 HGNCID:3084 Length:695 Species:Homo sapiens


Alignment Length:45 Identity:13/45 - (28%)
Similarity:22/45 - (48%) Gaps:16/45 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 ALDF-PQV--------------DKTYKPIFSMHEFTSMFGAKSQE 197
            ::|| |:|              ||.:..|.:.| |:::||..||:
Human   261 SVDFGPEVTSSDKSLKVLLNAEDKVFSEIRNEH-FSNVFGFLSQK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dshNP_511118.2 DAX 8..91 CDD:197474
Dishevelled <174..248 CDD:460544 10/38 (26%)
PDZ_Dishevelled-like 252..338 CDD:467201
DEP_dishevelled 395..478 CDD:239885
DVL1NP_001317240.1 DAX 1..85 CDD:197474
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..237
Dishevelled 90..247 CDD:460544
PDZ_Dishevelled-like 251..337 CDD:467201 13/45 (29%)
DEP_dishevelled 417..499 CDD:239885
Dsh_C 503..685 CDD:463531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.