DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1737 and VGLL4

Sequence 1:NP_001285118.1 Gene:CG1737 FlyBaseID:FBgn0030293 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_001121691.1 Gene:VGLL4 HGNCID:28966 Length:296 Species:Homo sapiens

Alignment Length:326 Identity:71/327 (22%)
Similarity:123/327 (38%) Gaps:90/327 (28%)


  Fly   140 RRSVQAETPKMFKVVSSKRVSTSPPPTIAASRSRRSIKPNPKYVSEDIVTPKYLAALADGGGQSI 204
            |...:.:|..:...:||.|  |.||| |:.|:.:.|::|.    .||:                 
Human    33 RGEPRIQTLPVASALSSHR--TGPPP-ISPSKRKFSMEPG----DEDL----------------- 73

  Fly   205 GTNDRRLVRLPRDEISDMLEFEEDDDDEVADAA--FNPQLHKSDDDDDDDISEAEYEQELRRKQP 267
                                  :.|:|.|:..:  |||.|:|:.:.|             .|:.|
Human    74 ----------------------DCDNDHVSKMSRIFNPHLNKTANGD-------------CRRDP 103

  Fly   268 PVKRGRGRPPKAKNVNANASATSAGNLTS--SSG-----ATSKISINSSSGRTASTSL-----QQ 320
               |.|.|.|..:.|....|...:...||  |.|     |.:|.|:::|.....|.:|     ||
Human   104 ---RERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQ 165

  Fly   321 MRRTMAT--NMAKSNASMTDGSSTGKGTAS---AAAKRKMDTSESESPVPRKRIIISGGSQQRSG 380
            .|.::.|  :....|.:::.......|.|:   |:.:|....:.:..||..:....|.|...:..
Human   166 NRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEP 230

  Fly   381 PPVVNGANSKMSAQ----RAI---TARPKVGQAGSASARMLPQRRG--SSNKINSLSNSNSNSIR 436
            .|..|..:...|..    :|:   ..:.|..:.|::|:.....|||  :|...:.:|:|:|.|:.
Human   231 EPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVV 295

  Fly   437 S 437
            |
Human   296 S 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1737NP_001285118.1 PRK13735 <284..>394 CDD:184287 27/127 (21%)
VGLL4NP_001121691.1 VGLL4 14..230 CDD:291898 55/259 (21%)
TDU 240..255 CDD:197839 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.