DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1737 and vgll4

Sequence 1:NP_001285118.1 Gene:CG1737 FlyBaseID:FBgn0030293 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_001072615.1 Gene:vgll4 XenbaseID:XB-GENE-997544 Length:291 Species:Xenopus tropicalis

Alignment Length:305 Identity:70/306 (23%)
Similarity:111/306 (36%) Gaps:93/306 (30%)


  Fly   161 TSPPPTIAASRSRRSIKPNPKYVSEDIVTPKYLAALADGGGQSIGTNDRRLVRLPRDEISDMLEF 225
            |:|||          |.|:.:.:|.|                   ..|..|              
 Frog    52 TAPPP----------ISPSKRKLSMD-------------------QGDEEL-------------- 73

  Fly   226 EEDDDDEVADAA--FNPQLHKSDDDDDDDISEAEYEQELR-RKQPPVKRGR------------GR 275
             |.|:|.|:..:  |.|.|.||.:.|        |.:|.| |.:.|::|..            |.
 Frog    74 -ECDNDHVSKMSRMFPPHLTKSLNGD--------YRKEHRDRSRSPIERAAAPTMSLHASHLYGI 129

  Fly   276 PPKAKNVNANASATSAGNLTSSSGATSKISINSSSGRTASTSLQQMRRTMATNMAKS--NASMTD 338
            ||.|  |:...:      ||.:|...|:     |.|...:...||.|.::.|....|  |.|::.
 Frog   130 PPLA--VDQPLA------LTKNSMDASR-----SMGIVPTMERQQNRPSVITCAPASNRNCSLSH 181

  Fly   339 GSSTGKGTASA---AAKRKMDTSESESPVPRKRIIISGGSQQRSGPPVVNGANSKMSAQ----RA 396
            ...|..|..||   :.:|..:|:.:..||..:....|.|...:...||.|..:...|..    :|
 Frog   182 CPVTHSGGVSAVPGSFRRPSNTTTACDPVVEEHFRRSLGKNYKEPEPVANSVSITGSVDDHFAKA 246

  Fly   397 I---TARPKVGQAGSASARMLPQRRG-SSNKINSLSNSNSNSIRS 437
            :   ..:.|..:.|..|:.....||| ||...:.:::::|.|:.|
 Frog   247 LGETWLQIKAAKDGGPSSPESASRRGQSSPSAHMMNHNHSPSVLS 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1737NP_001285118.1 PRK13735 <284..>394 CDD:184287 27/115 (23%)
vgll4NP_001072615.1 VGLL4 14..226 CDD:291898 54/239 (23%)
TDU 236..251 CDD:197839 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.