DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1737 and vgll4l

DIOPT Version :9

Sequence 1:NP_001285118.1 Gene:CG1737 / 32077 FlyBaseID:FBgn0030293 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_001073467.1 Gene:vgll4l / 562092 ZFINID:ZDB-GENE-070112-1682 Length:266 Species:Danio rerio


Alignment Length:244 Identity:57/244 - (23%)
Similarity:79/244 - (32%) Gaps:79/244 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VYV----RNLYDESSSRKDT-------PAGKLK-------GR--DNQREVQQELRGTRTTRRQS- 63
            ||:    .||..|...|..|       ||..:|       ||  :.:||.........:.||.| 
Zfish    18 VYILEGQPNLRSEDRFRHMTSDRVRMRPAHPMKRKHSSDRGRTLEERRERALSKCVANSARRSSG 82

  Fly    64 -VVQEKPTPRTRHAVKPAALSPSP--SSPSARSKLSRESAVKEQP----SSNLA----KRRGNLL 117
             .:.|.||........|..|.|||  |||.....|:.....:.:|    |.|.|    :.|.:::
Zfish    83 FSIPESPTSTWSPTASPTHLIPSPVFSSPVMDEPLALIKKPRPEPEKTESQNKATTQIQMRPSVI 147

  Fly   118 LGGS-----------NHPLSISPH-----------KLGLDKPQRRRSVQAETPKMFKVV------ 154
            ...|           ||..::|.|           .||::. .|..|:.......|...      
Zfish   148 TCVSSASRSTKQDCCNHSTAVSKHSYDHVEEHFQRSLGINY-HRATSISVSVDDHFAKALGDKWL 211

  Fly   155 -----------SSKRVSTSPP--PTIAASRSRRSIKPNPKYVSEDIVTP 190
                       ||...|:|||  ||...|...     :||...:|..:|
Zfish   212 QLKASSSSCHSSSSSSSSSPPSSPTFIHSPGY-----SPKRARKDSSSP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1737NP_001285118.1 PRK13735 <284..>394 CDD:184287
vgll4lNP_001073467.1 VGLL4 9..191 CDD:291898 41/173 (24%)
TDU 197..210 CDD:197839 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.