DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1737 and vgll4b

Sequence 1:NP_001285118.1 Gene:CG1737 FlyBaseID:FBgn0030293 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_998440.1 Gene:vgll4b ZFINID:ZDB-GENE-040426-2445 Length:282 Species:Danio rerio

Alignment Length:318 Identity:68/319 (21%)
Similarity:106/319 (33%) Gaps:94/319 (29%)


  Fly   144 QAETPKMFKVVSSKRVSTSPPPTIAASRSRRSIKPNPKYVSEDIVTPKYLAALADGGGQSIGTND 208
            ::....:...||:.|  |.|||          |.|:.:         |:.|..||   ..|..|.
Zfish    35 ESRMQSLSSAVSNHR--TGPPP----------ISPSKR---------KHSAEQAD---DDIDCNS 75

  Fly   209 RRLVRLPRDEISDMLEFEEDDDDEVADAAFNPQLHKSDDDDDDDISEAEYEQELRRKQPPVKRGR 273
            ..:.::.|                    .|..||.|..:.|             .||.|   |.|
Zfish    76 EHVAKMSR--------------------LFAAQLGKPANGD-------------YRKDP---RER 104

  Fly   274 GRPPKAKNVNANASATSAGNLTSSSGATSK---ISINSSSGR------TAS-TSLQQMRRTMAT- 327
            .|.|..:....:.|.....:|...|.|..:   ::.|..|.|      ||| ...||.|.::.| 
Zfish   105 SRSPIERMAAPSMSLVGGHHLYMPSLALDQPLALTKNMDSSRSMGISPTASPVERQQNRPSVITC 169

  Fly   328 ---NMAKSNASMTDGSSTGKGTASAAAKRKMDTSESE-SPVPRKRIIISGGSQQRSGPPVVNGAN 388
               |....|.|...||..|......|:.|:...|.:. .||..:....|.|...:...||.|..:
Zfish   170 APANNRNCNLSHCTGSHNGCSPGLNASYRRASNSNTACDPVIEEHFRRSLGKNYKEPEPVTNSVS 234

  Fly   389 ---------SKMSAQRAITARPKVGQAGSASARMLPQRRGSSNKINSLSNSNSNSIRS 437
                     :|...:..:..:.|   .||:|    |....:::.:|   :::|.|:.|
Zfish   235 ITGSVDDHFAKALGETWLQIKAK---GGSSS----PDASPNTHMVN---HNHSPSLVS 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1737NP_001285118.1 PRK13735 <284..>394 CDD:184287 31/134 (23%)
vgll4bNP_998440.1 VGLL4 14..226 CDD:291898 55/251 (22%)
TDU 236..251 CDD:197839 1/15 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.