DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1737 and Vgll4

Sequence 1:NP_001285118.1 Gene:CG1737 FlyBaseID:FBgn0030293 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_001015004.1 Gene:Vgll4 RGDID:1311653 Length:287 Species:Rattus norvegicus

Alignment Length:331 Identity:64/332 (19%)
Similarity:111/332 (33%) Gaps:109/332 (33%)


  Fly   140 RRSVQAETPKMFKVVSSKRVSTSPPPTIAASRSRRSIKPNPKYVSEDIVTPKYLAALADGGGQSI 204
            |...:.:|..:...:||.|  |.||| |:.|:.:.|::...|.:.                    
  Rat    33 RGEPRMQTLPVASALSSHR--TGPPP-ISPSKRKFSLEHGDKDLD-------------------- 74

  Fly   205 GTNDRRLVRLPRDEISDMLEFEEDDDDEVADAAFNPQLHKSDDDDDDDISEAEYEQELRRKQPPV 269
                     ...|.:|.|            ...|:|.|:|:.:.|             .|:.|  
  Rat    75 ---------CENDHVSKM------------SRIFSPHLNKTVNGD-------------CRRDP-- 103

  Fly   270 KRGRGRPPKAKNVNANASATSAGNLTSSSGATSK----ISINSSSGRTASTSLQQMRRTMAT--- 327
             |.|.|.| .:...|.|.:...|:|.:|..:..:    ::.|||....::...||.|.::.|   
  Rat   104 -RERSRSP-IERAAAPAVSLHGGHLYASLPSLMEQPLALTKNSSDTGRSAVERQQNRPSVITCAS 166

  Fly   328 ----NMAKSNASMTDGSSTGKGTASAAAKRKMDTSESESPVPRKRIIISGGSQQRSGPPVVNGAN 388
                |...|:..:.....:..|  ||:.:|....:.:..||..:....|.|...:...|..|..:
  Rat   167 AGARNCNLSHCPIAHSGCSAPG--SASYRRPPSATATCDPVVEEHFRRSLGKNYKEPEPAPNSVS 229

  Fly   389 ----------------------SKMSAQRAITARPKVGQAGSASARMLPQRRGSSNKINSLSNSN 431
                                  :|.||..:..:..:.||..|.:|.|             :|:|:
  Rat   230 ITGSVDDHFAKALGDTWLQIKAAKDSASSSPESASRRGQPASPTAHM-------------VSHSH 281

  Fly   432 SNSIRS 437
            |.|:.|
  Rat   282 SPSVVS 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1737NP_001285118.1 PRK13735 <284..>394 CDD:184287 27/143 (19%)
Vgll4NP_001015004.1 VGLL4 14..221 CDD:291898 49/251 (20%)
TDU 231..246 CDD:197839 0/15 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.