DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and YMR196W

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_013923.1 Gene:YMR196W SGDID:S000004809 Length:1088 Species:Saccharomyces cerevisiae

Alignment Length:1022 Identity:201/1023 (20%)
Similarity:321/1023 (31%) Gaps:387/1023 (38%)


  Fly    47 FSLSSNLILDKWKTMIGCVCLAIASYFGYLGYLETRVNTPFDHQKMVVHAGLEQPDRYWGSYRPL 111
            |.:|.|..|         ||:.:|.:.|....|:.|:            .||..|....|.....
Yeast    75 FGVSDNKQL---------VCMNVALWNGKDERLKERL------------FGLTGPQGNHGEDVKE 118

  Fly   112 TYFGMKTRDPHSLVMGLMWYTPSNLGPGGQGIRHWCEQGDKLDSYGWTHHDGRSFGVQEIQDL-- 174
            .||.:.....||.:..|..|......|..:.::...|:|          ::.:.|.|.:|..|  
Yeast   119 LYFYLDNTPTHSYMKALYKYPFKKAFPYKELVQKNGERG----------YEDKEFEVYDIDGLYR 173

  Fly   175 ----------------------PFELKTSFVKYPEGKQYGGDW--TARISVRNT-----TRAWDK 210
                                  |.||......:...|...|:.  ..::..|||     ||..||
Yeast   174 DSETGDNPYFDVFFEMAKDDENPSELNFRLTIHNRSKIDSGELYIAPQLFFRNTWAFDGTRTKDK 238

  Fly   211 SI--------SLIWYVALDERTNGHIKYVSDDKSPEPG--------------------------- 240
            .:        :||   .:..:..|:.:.|.   .|.||                           
Yeast   239 PLLERDAEAANLI---NMTHKKYGNCQMVF---QPSPGGFSSGTNEEEEDKEVEDIDPLLLFTDN 297

  Fly   241 ------VYGEAQGLGEF---QVRFHAVKGKILHKSYLSTVAPSLAKLKDTLFSHFRAFADKRGNR 296
                  ::.|.:...|:   ....:.|:||      ...|.|.....|.....||:...      
Yeast   298 ESNLVKLFNEEKNPSEYTKDAFEEYLVQGK------TDAVNPENKGTKACAVYHFKNIP------ 350

  Fly   297 FIGLPGEIVSQNGLPSSNPEPNFIAIQITAEVDFTLDITYQSTSGFSLGESIPKPPTGRAYQDSL 361
                |||.|:.....:::|:.:....|..|.||                            :|  
Yeast   351 ----PGEYVTVRYKFTNDPKNSIFKAQNLAVVD----------------------------ED-- 381

  Fly   362 QAKIAQFEQRFEDR--------FQLKQKGHSPEEVRFARNALSNLLGGIGYFY---------GSS 409
                 :|:..|::|        :::.....|.|.....|.|.|.|| ....||         |.:
Yeast   382 -----EFDLIFDNREEEADNFYWRITPLPISDELRNLQRQAFSGLL-WTKQFYNFTYDAWYNGDA 440

  Fly   410 RVQSVYTKNPVP--------YWKAPLY----TAVPSRSFFPRGFLWDEGFHGLLISAWDIDI--- 459
            .|:    ..|.|        .|| .||    .::|.:..:|....||..||.:.::..|.:.   
Yeast   441 NVK----PRPPPNRANGRNKNWK-HLYIEDILSMPDKWEYPFFASWDTAFHCIPLAMIDPEFAKR 500

  Fly   460 ELDIIC-HWFDLLNVEGWIPREQILGVEALAKVPEEFVTQRNSN-ANPPTFFLTLKKLLTSHRAE 522
            :||::. .|:  ::..|.||                 ..:.|.| .|||.....:.::....|..
Yeast   501 QLDLLTREWY--MHPNGQIP-----------------AYEWNFNDVNPPVHAWAVYRVFKIERNM 546

  Fly   523 LSQNGRLATLERLYPRVQAWFNWFNTTQRGEVLGTYLWRGRNATTTRELNPKSLSSGLDD---YP 584
            .::..| ..|||::.::...|.|:  ..|.:..|..::.|.             ..|||:   :.
Yeast   547 YNREDR-TFLERVFQKLLLNFTWW--VNRKDTEGKNVFEGG-------------FLGLDNIGVFN 595

  Fly   585 RASH-PTDKE-RHLDLRCWIALAAGVMAELSTLLGKDDAKYYETAS----------------YLT 631
            |:.. ||... ...|...|:|..:..|..::..|.|::..|.:.||                |.|
Yeast   596 RSEPLPTGGTLEQADSTGWMAFFSLQMLNIALELAKENPVYEDIASKFFEHFILISDSMSFEYAT 660

  Fly   632 D--------NVRLNRLHLAPYSEQYAD---WGLHTDQVKLKRPPSMAPQQQQRHHHQHYQLPEMQ 685
            |        .::.|..:.|  .:.|.|   ||.|                       ..||| ::
Yeast   661 DITGEKCKEVIKQNLWNEA--DKFYYDAISWGDH-----------------------KVQLP-IR 699

  Fly   686 RVTGELPTY-----------QF------VDSAFGYVSLFP------------------LLLEQLD 715
            .:.|.:|.|           ||      ||   .:|:..|                  |||..:.
Yeast   700 SLVGLIPLYASMTLEPSIIKQFRGFKKRVD---WFVNNRPEIFDRNIASMSKKGVGERLLLSLVT 761

  Fly   716 HDSPYLTKLLNDLRDPEQLWTNYGLRSLSK---RSPLYMQRN-TEHDPPY--------------- 761
            .:.  ||.:|:.|.|..:..:.||:|||||   :.|..|..| .|:...|               
Yeast   762 KER--LTAILSRLLDETEFLSPYGIRSLSKYHEKHPFEMNVNGVEYMVKYLPGESDSGMFGGNSN 824

  Fly   762 WRGPIWININYLAAKALH----HYG---KIDGP-------NAALA------RQIYAELRDNLVGN 806
            ||||||...::|..:||.    :||   |::.|       |.|..      |.|:..:.|.....
Yeast   825 WRGPIWFPTSFLIMEALQRFYLYYGSDFKVECPVGSGDYLNLAEVAEELGYRMIHLFVPDENGER 889

  Fly   807 ILRQYKRSGYL------------WEQYDDTSGEGKGCNPFTGWTATV 841
            .:.....|.:|            :|.:|..:|.|.|.:...||||.|
Yeast   890 AIHYGDHSKFLSSDPYFRDYVPFFEYFDGDTGRGLGASHQCGWTALV 936

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 41/254 (16%)
Glyco_hydro_63 352..847 CDD:281228 136/643 (21%)
YMR196WNP_013923.1 Trehalase 476..936 CDD:302639 113/526 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.