DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and CWH41

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_011488.1 Gene:CWH41 SGDID:S000002995 Length:833 Species:Saccharomyces cerevisiae

Alignment Length:861 Identity:248/862 (29%)
Similarity:384/862 (45%) Gaps:197/862 (23%)


  Fly   105 WGSYRPLTYFGMKTRDPHS--LVMGLMWYTPSNLGPGG-QGIRHWCEQGDKLDSYGWTHHD---- 162
            |..||...||||:.|..|.  |:||:||:  ::|...| ..:||:....|||..|||..:|    
Yeast    47 WAPYRSNCYFGMRPRYVHESPLIMGIMWF--NSLSQDGLHSLRHFATPQDKLQKYGWEVYDPRIG 109

  Fly   163 GRSFGVQEIQDLPFELKTSFVKYPEGKQYGGDWTARISVRNTTRAWDKSISLIWYVA-----LDE 222
            |:...:.|..:|  .|...|||...|:    :|:.|:...........:.|::.|.:     :|.
Yeast   110 GKEVFIDEKNNL--NLTVYFVKSKNGE----NWSVRVQGEPLDPKRPSTASVVLYFSQNGGEIDG 168

  Fly   223 RTNGHIKYVSDDKSPEPGVYGEAQGLGEFQVRFHAVKGKILH--------------------KSY 267
            :::  :..:..|...:...:|.::.|||:.:   .||....|                    .|:
Yeast   169 KSS--LAMIGHDGPNDMKFFGYSKELGEYHL---TVKDNFGHYFKNPEYETMEVAPGSDCSKTSH 228

  Fly   268 LSTVAP--SLAKLKDTLFS----HFRAFADKR--GNRFIGLPGEIVSQNGLPSSNPEPNFIAIQ- 323
            ||...|  .:.|.:|...|    ..|...:|.  ..|...|...:::...|.:.|| .||..|| 
Yeast   229 LSLQIPDKEVWKARDVFQSLVSDSIRDILEKEETKQRPADLIPSVLTIRNLYNFNP-GNFHYIQK 292

  Fly   324 ---ITAEVDFTLDITYQ---STSGFSLGESIPKPPTGRAYQDSLQAKIAQFEQRFEDRFQLKQKG 382
               :|.:..|..||||.   :|...|..|.:         .:.:...:.:...||:.:|..   |
Yeast   293 TFDLTKKDGFQFDITYNKLGTTQSISTREQV---------TELITWSLNEINARFDKQFSF---G 345

  Fly   383 HSPEEV-------RFARNALSNLLGGIGYFYGSSRV-------QSVYT-------KNPVPYWKAP 426
            ..|:.:       |||...|||||||||||||:..:       :|.:|       |...|:   .
Yeast   346 EGPDSIESVEVKRRFALETLSNLLGGIGYFYGNQLIDRETEFDESQFTEIKLLNAKEEGPF---E 407

  Fly   427 LYTAVPSRSFFPRGFLWDEGFHGLLISAWDIDIELDIICHWFDLLNVE-GWIPREQILGVEALAK 490
            |:|:||||.||||||.||||||.|.|..:|.|:..:|:..||:::..: |||.||.|||.||.:|
Yeast   408 LFTSVPSRGFFPRGFYWDEGFHLLQIMEYDFDLAFEILASWFEMIEDDSGWIAREIILGNEARSK 472

  Fly   491 VPEEFVTQRNSNANPPTFFLTLKKLLTS-------------HRA------------ELSQNGRLA 530
            ||:||..|..:.|||||..|...::|:.             |:.            .|..|..|.
Yeast   473 VPQEFQVQNPNIANPPTLLLAFSEMLSRAIENIGDFNSDSYHQVMFNSRTAKFMTNNLEANPGLL 537

  Fly   531 T--LERLYPRVQAWFNWFNTTQRG------EVL------------GTYLWRGRNATTTRELNPKS 575
            |  .:::||::...:|||..:|.|      |:|            ..|.|.||..|       ..
Yeast   538 TEYAKKIYPKLLKHYNWFRKSQTGLIDEYEEILEDEGIWDKIHKNEVYRWVGRTFT-------HC 595

  Fly   576 LSSGLDDYPRASHPTDKERHLDLRCWIALAAGVMAELSTL--LGKDDAKYYETASYLTDNVRLNR 638
            |.||:||||||..|...|.::|...|:.:....|.:::.:  |.:|:.:|.:....:.:|  |:.
Yeast   596 LPSGMDDYPRAQPPDVAELNVDALAWVGVMTRSMKQIAHVLKLTQDEQRYAQIEQEVVEN--LDL 658

  Fly   639 LHLAPYSEQYADWGLHTDQVKLKRPPSMAPQQQQRHHHQHYQLPEMQRVTGELPTYQFVDSAFGY 703
            ||.:.....|.|..:..:..:::                                 :||... ||
Yeast   659 LHWSENDNCYCDISIDPEDDEIR---------------------------------EFVCHE-GY 689

  Fly   704 VSLFPLLLEQLDHDSPYLTKLLNDLRDPEQLWTNYGLRSLSKRSPLYMQRNTEHDPPYWRGPIWI 768
            ||:.|..|:.:..:||.|.|::..:.|||:::::|||.|||::...:.:     |..|||||||:
Yeast   690 VSVLPFALKLIPKNSPKLEKVVALMSDPEKIFSDYGLLSLSRQDDYFGK-----DENYWRGPIWM 749

  Fly   769 NINYLAAKALHHYGK---ID-GPNAALARQIYAELRDNLVGNILRQYKRSGYLWEQYDDTSGEGK 829
            |||||...|:.:|..   :| ...|:.|:::|..|:.||..||.:.::..||.:|.|....|.|.
Yeast   750 NINYLCLDAMRYYYPEVILDVAGEASNAKKLYQSLKINLSNNIYKVWEEQGYCYENYSPIDGHGT 814

  Fly   830 GCNPFTGWTATVVLLM 845
            |...||||||.||.::
Yeast   815 GAEHFTGWTALVVNIL 830

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 52/212 (25%)
Glyco_hydro_63 352..847 CDD:281228 175/568 (31%)
CWH41NP_011488.1 Glyco_hydro_63N 45..266 CDD:293528 56/232 (24%)
Glyco_hydro_63 319..832 CDD:281228 176/576 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332875288
eggNOG 1 0.900 E1_KOG2161
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 291 1.000 Inparanoid score I524
Isobase 1 0.950 0 Normalized mean entropy S1986
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 1 1.000 T1136816
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 LDO PTHR10412
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R480
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.