DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and GCS1

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_176916.2 Gene:GCS1 AraportID:AT1G67490 Length:852 Species:Arabidopsis thaliana

Alignment Length:887 Identity:359/888 (40%)
Similarity:495/888 (56%) Gaps:81/888 (9%)


  Fly     5 TGSSSGSTPAASSSGSSAAAAAAAAAAAAAASNAKQKQRSPRFSLSSNLILDKWKTMIGCVCLAI 69
            ||:|..|......|.|.:..:...:|...:....|.|:.....:..:||     |.::|.:.|.|
plant     2 TGASRRSARGRIKSSSLSPGSDEGSAYPPSIRRGKGKELVSIGAFKTNL-----KILVGLIILGI 61

  Fly    70 ASYFGYLGYL-----------ETRVNTPFDHQKMV---VHAGLEQPDRYWGSYRPLTYFGMKTRD 120
            ...:..:..|           :.||.|||...|::   :..|..:...|||:|||..|||::.|.
plant    62 IVIYFVINRLVRHGLLFDESQKPRVITPFPAPKVMDLSMFQGEHKESLYWGTYRPHVYFGVRART 126

  Fly   121 PHSLVMGLMWYTPSNLGPGGQ--GIRHWCEQGDKLDSYGWTHHDGRSFGVQEIQDLPFELKTSFV 183
            |.|||.||||     ||...:  .:||:||..|.|.::||..|:||.:|.||:.:....::||||
plant   127 PLSLVAGLMW-----LGVKDEMYVMRHFCENSDDLSTFGWREHNGRDYGRQELVENDMVIETSFV 186

  Fly   184 KYP-EGKQYGGDWTARISVRNTTRAWD--KSISLIWYVALDERTNGHIKYVSDDKSPEPG----V 241
            |.. :|..|||||..||.|:|.....|  :|..|.:|:| ||  .|::..:..|.....|    |
plant   187 KSKGDGLGYGGDWAVRIDVKNKGLNDDVKRSAHLFFYLA-DE--GGNVLNLGQDGLDFQGSSLLV 248

  Fly   242 YGEAQGLGEFQVRFHAVKGKILHKSYLSTVAPSLAKLKDTLFSHFRAFADKRGNRFIGLPGEIVS 306
            .|..:.:|::|:  |......|...|.....|.:..|.|.:..:....|.|.|...:.       
plant   249 SGSREDVGDWQI--HLKSQNQLETHYSGFKTPHIYNLSDLVQQNLALQARKFGRLQLS------- 304

  Fly   307 QNGLPSSNPEPNFIAIQITAEVDFTLDITYQSTSGFSLGES--IPK---PPTGRAYQDSLQAKIA 366
                .:|....|....||:..:.||:||.:  .||.. |||  :.|   ..||....|.|:.|..
plant   305 ----DTSEDSSNIYIFQISGRLPFTIDIPF--ISGIK-GESSNVEKRLTSLTGLPLSDLLKKKHQ 362

  Fly   367 QFEQRFEDRFQLKQKGHSPEEVRFARNALSNLLGGIGYFYGSSRVQSVYTKNP------VPYWKA 425
            :|:.:|.:.|:|.:| |..|.:...|.|::|:|||||||||.|::....:..|      :.||.|
plant   363 EFDAKFNECFKLSEK-HDSETLGVGRTAIANMLGGIGYFYGQSKIYVPKSTQPGSRDNFLLYWPA 426

  Fly   426 PLYTAVPSRSFFPRGFLWDEGFHGLLISAWDIDIELDIICHWFDLLNVEGWIPREQILGVEALAK 490
            .||||||||.|||||||||||||.|||..|||.|.|||:.||.||||::||||||||||.|||:|
plant   427 ELYTAVPSRPFFPRGFLWDEGFHQLLIWRWDIRITLDIVGHWLDLLNIDGWIPREQILGAEALSK 491

  Fly   491 VPEEFVTQRNSNANPPTFFLTLKKLLTSHRAE----LSQNGRLATLERLYPRVQAWFNWFNTTQR 551
            ||||||.|..||.||||.||.::.|:.:.|.|    ..::..|:.|||...|:.|||.||||:|:
plant   492 VPEEFVVQYPSNGNPPTLFLVIRDLIDAIRMEKFVASEKDEVLSFLERASVRLDAWFQWFNTSQK 556

  Fly   552 GEVLGTYLWRGRNATTTRELNPKSLSSGLDDYPRASHPTDKERHLDLRCWIALAAGVMAELSTLL 616
            |:.:|:|.|.||:.|||:|||||:||||||||||||||::.|||:|||||:.|||..|..::.||
plant   557 GKEIGSYFWHGRDNTTTQELNPKTLSSGLDDYPRASHPSEDERHVDLRCWMYLAADCMHSITELL 621

  Fly   617 GKDD----AKYYETASYLTDNVRLNRLHLAPYSEQYADWGLHTDQVKLKRPPSMAPQQQQRHHHQ 677
            ||:|    ..|..|...|::...||::|.......|.|:|.||::|||.....:....|...   
plant   622 GKEDKLSKENYNSTVKLLSNFNLLNQMHYDSDYGAYFDFGNHTEKVKLIWKEVIQENGQLSR--- 683

  Fly   678 HYQLPEMQRVTGELPTYQFVDSAFGYVSLFPLLLEQLDHDSPYLTKLLNDLRDPEQLWTNYGLRS 742
                 ::.|.|...|..:.|.. .||||.||.:...:..|||.|.|.|:.:.:...||::|||.|
plant   684 -----QLVRKTFGKPKLKLVPH-LGYVSFFPFMSRIIPPDSPILEKQLDLISNRSILWSDYGLVS 742

  Fly   743 LSKRSPLYMQRNTEHDPPYWRGPIWININYLAAKALHHYGKIDGPNAALARQIYAELRDNLVGNI 807
            |:|.|.:||:||||||.||||||||:|:||:...:|:||..:|||....::.||.|||.||:.|:
plant   743 LAKTSSMYMKRNTEHDAPYWRGPIWMNMNYMILSSLYHYSIVDGPYREKSKAIYTELRSNLIRNV 807

  Fly   808 LRQYKRSGYLWEQYDDTSGEGKGCNPFTGWTATVVLLMAEQF 849
            :|.|..:||:|||||...|.|||...||||:|..:|:|:|.:
plant   808 VRNYYETGYIWEQYDQVKGTGKGTRLFTGWSALTLLIMSEDY 849

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 69/188 (37%)
Glyco_hydro_63 352..847 CDD:281228 249/509 (49%)
GCS1NP_176916.2 Glyco_hydro_63N 109..>274 CDD:293528 61/174 (35%)
Glyco_hydro_63 348..847 CDD:281228 250/514 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4593
Inparanoid 1 1.050 600 1.000 Inparanoid score I214
OMA 1 1.010
OrthoDB 1 1.010 D278028at2759
OrthoInspector 1 1.000 T125058
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 LDO PTHR10412
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.