DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and AT1G24320

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_173842.2 Gene:AT1G24320 AraportID:AT1G24320 Length:789 Species:Arabidopsis thaliana

Alignment Length:797 Identity:323/798 (40%)
Similarity:446/798 (56%) Gaps:61/798 (8%)


  Fly    82 RVNTPFDHQKMV---VHAGLEQPDRYWGSYRPLTYFGMKTRDPHSLVMGLMWYTPSNLGPGGQGI 143
            ||.|||...|:.   :..|..:...|||:|||..|||::.|.|.|||.||||..   :..|...:
plant    22 RVITPFPSPKLTDLSMFQGEHKESLYWGTYRPQMYFGVRARTPKSLVAGLMWLV---MKDGKPVM 83

  Fly   144 RHWCEQGDKLDSYGWTHHDGRSFGVQEIQDLPFELKTSFVKYPEGK-QYGGDWTARISVRNTTRA 207
            ||:||..:.|.|:||..|:||.||.||:.:....|:|||||..||. .|||||:.||:|:|....
plant    84 RHFCENSNDLKSFGWKEHNGRDFGRQELFEQNMVLETSFVKSEEGSLGYGGDWSIRINVQNMLND 148

  Fly   208 WD--KSISLIWYVALDERTNGHI--KYVSDDKSPEPGVYGEAQGLGEFQVRFHAVKGKILHKSYL 268
            .:  :|..|.:|:| ||..||..  |.|...|.......|..|.:|.:|:  |......|...|.
plant   149 DEVKRSTHLFFYLA-DEGCNGVNLGKDVLRLKESSVLASGSRQDVGNWQM--HLKSQNHLETHYC 210

  Fly   269 STVAPSLAKLKDTLFSHFRAFADKRGNRFIGLPGEIVSQNGLPSSNPEPNFIAIQITAEVDFTLD 333
            ....|.:..|...:..:..|..:|.|...:.           .||....|....||:.....|:|
plant   211 GFKTPDIVNLSGLVQQNLTAQEEKSGLLQLS-----------DSSEDSSNIYVFQISTTNQSTID 264

  Fly   334 ITY-----QSTSGFSLGESIPKPPTGRAYQDSLQAKIAQFEQRFEDRFQLKQKGHSPEEVRFARN 393
            |.:     :.||..   |:.....||......|:.|...|..:|.:.|.|..| ..||.:...:.
plant   265 IAFVSGIKEETSNM---ENRIMSLTGLPLSSLLEEKHIAFNAKFNECFNLSDK-LDPETLVVGKA 325

  Fly   394 ALSNLLGGIGYFYGSSRVQSVYTKNPVP--------YWKAPLYTAVPSRSFFPRGFLWDEGFHGL 450
            |:.|:|||||||||.|::.  :.|:|:.        ||.|.||||||||..||||||||||||.|
plant   326 AIGNMLGGIGYFYGQSKIH--FPKSPLAKSEDDFLLYWPAELYTAVPSRPRFPRGFLWDEGFHQL 388

  Fly   451 LISAWDIDIELDIICHWFDLLNVEGWIPREQILGVEALAKVPEEFVTQRNSNANPPTFFLTLKKL 515
            ||..||:.|.|:|:.:|.||:|::|||||||:||.|||:|:|:::|.|..||.||||..|.::.|
plant   389 LIWRWDVHITLEIVGNWLDLMNIDGWIPREQVLGAEALSKIPKQYVVQFPSNGNPPTLLLVIRDL 453

  Fly   516 LTSHRA----ELSQNGRLATLERLYPRVQAWFNWFNTTQRGEVLGTYLWRGRNATTTRELNPKSL 576
            :...|.    |..::..|:.|:|.:.|:.|||.||||:|.|:..|:|.|.||:..|.|||||:||
plant   454 INGIRTEKFNEADRDKILSFLDRAFVRLDAWFKWFNTSQIGKEKGSYYWHGRDNITNRELNPQSL 518

  Fly   577 SSGLDDYPRASHPTDKERHLDLRCWIALAAGVMAELSTLLGKDD----AKYYETASYLTDNVRLN 637
            |||||||||||||.:.|||:|||||:.|||..|..:...:||:|    ..|...|..|:|...||
plant   519 SSGLDDYPRASHPNEDERHVDLRCWMYLAADSMNSIQEFMGKNDILVTEDYSSIAKLLSDFTLLN 583

  Fly   638 RLHLAPYSEQYADWGLHTDQVKLKRPPSMAPQQQQRHHHQHYQLPEMQRVTGELPTYQFVDSAFG 702
            ::|.......|.|:|.||::|:|        ..::..|...:...|:.|.|...|..:.|.. .|
plant   584 QMHYDKDHGAYLDFGNHTEEVRL--------VWKEVIHEDGHLSRELVRETYGKPELRLVPH-IG 639

  Fly   703 YVSLFPLLLEQLDHDSPYLTKLLNDLRDPEQLWTNYGLRSLSKRSPLYMQRNTEHDPPYWRGPIW 767
            |||.||.:...:..||..|.|.|:.:.:...:|::|||.||:|.|.|||:.|:||..|||||.||
plant   640 YVSFFPFMFRIIPADSSILDKQLDLISNGNIVWSDYGLLSLAKTSSLYMKYNSEHQAPYWRGAIW 704

  Fly   768 ININYLAAKALHHYGKIDGPNAALARQIYAELRDNLVGNILRQYKRSGYLWEQYDDTSGEGKGCN 832
            :|:||:...:||||..:|||..:.||.||.|||.||:.|::|.|.::|.:||.||.|.|.|:|..
plant   705 MNMNYMILSSLHHYSTVDGPYNSKARTIYEELRSNLIRNVVRNYDQTGIIWEHYDQTKGTGEGAR 769

  Fly   833 PFTGWTATVVLLMAEQF 849
            .||||:|.::|:|:|::
plant   770 VFTGWSALILLIMSEEY 786

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 71/184 (39%)
Glyco_hydro_63 352..847 CDD:281228 230/511 (45%)
AT1G24320NP_173842.2 Glyco_hydro_63N 46..>200 CDD:293528 67/160 (42%)
Glyco_hydro_63 285..784 CDD:281228 230/511 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4593
Inparanoid 1 1.050 600 1.000 Inparanoid score I214
OMA 1 1.010
OrthoDB 1 1.010 D278028at2759
OrthoInspector 1 1.000 T125058
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 O PTHR10412
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.