DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and Gcs1

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_113937.1 Gene:Gcs1 RGDID:69240 Length:834 Species:Rattus norvegicus

Alignment Length:895 Identity:363/896 (41%)
Similarity:477/896 (53%) Gaps:129/896 (14%)


  Fly     2 ARNTGSSSGSTPAASSSGSSAAAAAAAAAAAAAASNAKQKQRSPRFSLSSNLILDKWKTMIGCVC 66
            ||..|...|.  |..:.||:..||.|....|.|            |.||...:|           
  Rat    22 ARGAGRRDGR--AGGARGSAGGAALAVVVLALA------------FGLSGRWVL----------- 61

  Fly    67 LAIASYFGYLGYLETRVNT--------PFDHQKMVVHAGLEQPDRYWGSYRPLTYFGMKTRDPHS 123
                   .:||.  .|..|        |.|.....|     .|:.:||:|||..|||||||.|..
  Rat    62 -------AWLGV--RRALTLHPAPSALPPDSSSPAV-----APEFFWGTYRPHVYFGMKTRSPKP 112

  Fly   124 LVMGLMWY-------TPSNLGPGGQGIRHWCEQGDKLDSYGWTHHDGRSFGVQEIQDLPFELKTS 181
            |:.||||.       ||..|       ||.|||||.:..|||..|||.|||.|.|.|....|.|.
  Rat   113 LLTGLMWAQQGATPGTPPKL-------RHTCEQGDGVGPYGWEFHDGLSFGRQHIYDGALRLTTE 170

  Fly   182 FVKYPEGKQYGGDWTARISVRNTTRAWDK--SISLIWYVALDER--------TNGHIKYVSDDKS 236
            ||| ..|..:||||:.|::|.........  .:||.:||..|.:        ..|.:|::|    
  Rat   171 FVK-RSGGHHGGDWSWRVTVEPQASGTPSFPLVSLFFYVVTDGQEVLLPEVGAKGQLKFIS---- 230

  Fly   237 PEPGVYGEAQGLGEFQVRF--HAVKGKIL--HKSY--LSTVAPSLAKLKDTLFSHFRAFADKR-- 293
                  |....||:|::..  ....|..:  |.||  ..:..|.|..|.|.:.||..::...|  
  Rat   231 ------GHTSELGDFRLTLLPPTTPGDTVPKHGSYNVFWSSNPGLPLLTDMVKSHLNSWFHHRPP 289

  Fly   294 ---GNRFIGLPGEIVSQNGLPSSNPEPNFIAIQITAEVDFTLDITYQSTSGFSLGESIPKPPTGR 355
               ..|::||||.:..:...||.  :..|:..|:|.:..|:::..::|.|..:..:...:...|.
  Rat   290 GASPERYLGLPGSLKWEERGPSG--QGQFLVQQVTLKAPFSVEFVFESGSARTGRDQASEQLVGG 352

  Fly   356 AYQDSLQAKIAQFEQRFEDRFQLKQKGHSPEEVRFARNALSNLLGGIGYFYGSSRV-------QS 413
            ....:|::..|.|::|||..||||:||.||||....:.|||.||||||||||...|       .|
  Rat   353 QLTRALESHAAAFKERFERTFQLKEKGLSPEEQALGQVALSGLLGGIGYFYGQGLVLPDTGMEGS 417

  Fly   414 VYTKNPVPYWKAPLYTAVPSRSFFPRGFLWDEGFHGLLISAWDIDIELDIICHWFDLLNVEGWIP 478
            ....:|..:...||::.||||||||||||||||||.|::..||..:..:.:.||..|||.:|||.
  Rat   418 EQKMDPSLFPPVPLFSGVPSRSFFPRGFLWDEGFHQLVVQRWDPHLTREALGHWLGLLNADGWIG 482

  Fly   479 REQILGVEALAKVPEEFVTQRNSNANPPTFFLTLKKLLTSHRAELSQNGRLATLERLYPRVQAWF 543
            ||||||.||.|:||.||:.||.::|||||..|.:..:|.....|     .||.|.|.:||:.|||
  Rat   483 REQILGDEARARVPPEFLVQRAAHANPPTLLLPVIHMLEGRAPE-----DLAFLRRAFPRLHAWF 542

  Fly   544 NWFNTTQRGEVLGTYLWRGRNATTTRELNPKSLSSGLDDYPRASHPTDKERHLDLRCWIALAAGV 608
            :|.:.:|.|.|..:|.||||:......||||:|.||||||||||||:..|||||||||:.|.|.|
  Rat   543 SWLHQSQAGPVPLSYRWRGRDLALPTLLNPKTLPSGLDDYPRASHPSAAERHLDLRCWVTLGARV 607

  Fly   609 MAELSTLLGKDD--AKYYETASYLTDNVRLNRLHLAPYSEQYADWGLHTDQVKLK-RPPSMAPQQ 670
            :::|:..||:.:  |:....|:.|.....|:.||.||....:||:|.||..|:|| |||.     
  Rat   608 LSQLAEELGETEAAAELGPLAASLEAAGSLDELHWAPELGVFADFGNHTKAVQLKSRPPQ----- 667

  Fly   671 QQRHHHQHYQLPEMQRVTGELPT-YQFVDSAFGYVSLFPLLLEQLDHDSPYLTKLLNDLRDPEQL 734
                        .:.||.|..|. .|:|| |.||||||||||:.|:..||.|..||:.|.|...|
  Rat   668 ------------GLVRVVGRPPARLQYVD-ALGYVSLFPLLLQLLEPSSPRLGPLLDVLADSRHL 719

  Fly   735 WTNYGLRSLSKRSPLYMQRNTEHDPPYWRGPIWININYLAAKALHHYGKIDGPNAALARQIYAEL 799
            |:.:||||||..|..|.|||||||||||||.:|:||||||..||||||:::||:...|.::|.||
  Rat   720 WSPFGLRSLSASSLFYKQRNTEHDPPYWRGAVWLNINYLALGALHHYGRVEGPHKVQAAKLYREL 784

  Fly   800 RDNLVGNILRQYKRSGYLWEQYDDTSGEGKGCNPFTGWTATVVLLMAEQF 849
            |.|:|.|:.:||:.:|:|||||.|..|.|.||.||.|||:.|:|:|||::
  Rat   785 RANVVSNVRQQYQATGFLWEQYSDQDGRGMGCRPFQGWTSLVLLIMAEEY 834

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 72/202 (36%)
Glyco_hydro_63 352..847 CDD:281228 250/506 (49%)
Gcs1NP_113937.1 Endoplasmic reticulum targeting 3..9
Required for endoplasmic reticulum targeting. {ECO:0000250} 74..136 27/74 (36%)
Glyco_hydro_63N 93..284 CDD:293528 74/209 (35%)
Glyco_hydro_63 349..832 CDD:281228 250/506 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332864494
eggNOG 1 0.900 E1_KOG2161
Hieranoid 1 1.000
Homologene 1 1.000 H4593
Inparanoid 1 1.050 592 1.000 Inparanoid score I927
OMA 1 1.010
OrthoDB 1 1.010 D162821at33208
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 1 1.000 T619143
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 LDO PTHR10412
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.