DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and MOGS

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_006293.2 Gene:MOGS HGNCID:24862 Length:837 Species:Homo sapiens

Alignment Length:788 Identity:345/789 (44%)
Similarity:453/789 (57%) Gaps:81/789 (10%)


  Fly   101 PDRYWGSYRPLTYFGMKTRDPHSLVMGLMWYTPSNLGPGGQGIRHWCEQGDKLDSYGWTHHDGRS 165
            ||.:||:|||..|||||||.|..|:.|||| ......||...:||.|||||.:..|||..|||.|
Human    92 PDLFWGTYRPHVYFGMKTRSPKPLLTGLMW-AQQGTTPGTPKLRHTCEQGDGVGPYGWEFHDGLS 155

  Fly   166 FGVQEIQDLPFELKTSFVKYPEGKQYGGDWTARISVR---NTTRAWDKSISLIWYVALDER---- 223
            ||.|.|||....|.|.|||.| |.|:||||:.|::|.   :.|.|. ..:||.:||..|.:    
Human   156 FGRQHIQDGALRLTTEFVKRP-GGQHGGDWSWRVTVEPQDSGTSAL-PLVSLFFYVVTDGKEVLL 218

  Fly   224 ----TNGHIKYVSDDKSPEPGVYGEAQGLGEFQVRFHAV----KGKILHK--SY--LSTVAPSLA 276
                ..|.:|::|          |....||:|  ||..:    .|....|  ||  ..|..|.|.
Human   219 PEVGAKGQLKFIS----------GHTSELGDF--RFTLLPPTSPGDTAPKYGSYNVFWTSNPGLP 271

  Fly   277 KLKDTLFSHFRAFADKR-----GNRFIGLPGEIVSQNGLPSSNPEPNFIAIQITAEVDFTLDITY 336
            .|.:.:.|...::...|     ..|::||||.:..::..||...:..|:..|:|.::..:::..:
Human   272 LLTEMVKSRLNSWFQHRPPGAPPERYLGLPGSLKWEDRGPSGQGQGQFLIQQVTLKIPISIEFVF 336

  Fly   337 QSTSGFSLG-ESIPKPPTGRAYQDSLQAKIAQFEQRFEDRFQLKQKGHSPEEVRFARNALSNLLG 400
            :|.|..:.| :::|: ..|.....:|::....|.:|||..||||:||.|..|....:.|||.|||
Human   337 ESGSAQAGGNQALPR-LAGSLLTQALESHAEGFRERFEKTFQLKEKGLSSGEQVLGQAALSGLLG 400

  Fly   401 GIGYFYGSSRV----------QSVYTKNPVPYWKAPLYTAVPSRSFFPRGFLWDEGFHGLLISAW 455
            |||||||...|          |.|   :|..:...||:||||||||||||||||||||.|::..|
Human   401 GIGYFYGQGLVLPDIGVEGSEQKV---DPALFPPVPLFTAVPSRSFFPRGFLWDEGFHQLVVQRW 462

  Fly   456 DIDIELDIICHWFDLLNVEGWIPREQILGVEALAKVPEEFVTQRNSNANPPTFFLTLKKLLTSHR 520
            |..:..:.:.||..|||.:|||.||||||.||.|:||.||:.||..:|||||..|.:     :|.
Human   463 DPSLTREALGHWLGLLNADGWIGREQILGDEARARVPPEFLVQRAVHANPPTLLLPV-----AHM 522

  Fly   521 AELSQNGRLATLERLYPRVQAWFNWFNTTQRGEVLGTYLWRGRNATTTRELNPKSLSSGLDDYPR 585
            .|:.....||.|.:..||:.|||:|.:.:|.|.:..:|.||||:......||||:|.||||||||
Human   523 LEVGDPDDLAFLRKALPRLHAWFSWLHQSQAGPLPLSYRWRGRDPALPTLLNPKTLPSGLDDYPR 587

  Fly   586 ASHPTDKERHLDLRCWIALAAGVMAELSTLLGKDD--AKYYETASYLTDNVRLNRLHLAPYSEQY 648
            ||||:..|||||||||:||.|.|:..|:..||:.:  |:....|:.|.....|:.||.||....:
Human   588 ASHPSVTERHLDLRCWVALGARVLTRLAEHLGEAEVAAELGPLAASLEAAESLDELHWAPELGVF 652

  Fly   649 ADWGLHTDQVKLK-RPPSMAPQQQQRHHHQHYQLPEMQRVTGE-LPTYQFVDSAFGYVSLFPLLL 711
            ||:|.||..|:|| |||.                 .:.||.|. .|..|:|| |.||||||||||
Human   653 ADFGNHTKAVQLKPRPPQ-----------------GLVRVVGRPQPQLQYVD-ALGYVSLFPLLL 699

  Fly   712 EQLDHDSPYLTKLLNDLRDPEQLWTNYGLRSLSKRSPLYMQRNTEHDPPYWRGPIWININYLAAK 776
            ..||..|..|..||:.|.|...||:.:|||||:..|..|.|||:|||||||||.:|:|:||||..
Human   700 RLLDPTSSRLGPLLDILADSRHLWSPFGLRSLAASSSFYGQRNSEHDPPYWRGAVWLNVNYLALG 764

  Fly   777 ALHHYGKIDGPNAALARQIYAELRDNLVGNILRQYKRSGYLWEQYDDTSGEGKGCNPFTGWTATV 841
            ||||||.::||:.|.|.:::.|||.|:|||:.|||:.:|:|||||.|..|.|.||.||.|||:.|
Human   765 ALHHYGHLEGPHQARAAKLHGELRANVVGNVWRQYQATGFLWEQYSDRDGRGMGCRPFHGWTSLV 829

  Fly   842 VLLMAEQF 849
            :|.|||.:
Human   830 LLAMAEDY 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 78/198 (39%)
Glyco_hydro_63 352..847 CDD:281228 248/509 (49%)
MOGSNP_006293.2 Endoplasmic reticulum targeting 3..9
Required for endoplasmic reticulum targeting. {ECO:0000250} 76..137 24/46 (52%)
Glyco_hydro_63N 94..>244 CDD:319009 70/165 (42%)
Glyco_hydro_63 352..835 CDD:308692 248/509 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332864963
eggNOG 1 0.900 E1_KOG2161
Hieranoid 1 1.000
Homologene 1 1.000 H4593
Inparanoid 1 1.050 591 1.000 Inparanoid score I975
Isobase 1 0.950 0 Normalized mean entropy S1986
OMA 1 1.010
OrthoDB 1 1.010 D162821at33208
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 1 1.000 T1075184
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 LDO PTHR10412
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R480
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.