DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and mogs

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:XP_004911601.3 Gene:mogs XenbaseID:XB-GENE-5911793 Length:597 Species:Xenopus tropicalis

Alignment Length:608 Identity:289/609 (47%)
Similarity:393/609 (65%) Gaps:52/609 (9%)


  Fly   266 SYLSTVAPSLAKLKDTL-------FSHFRAFADKRGN--RFIGL----PGEIVSQNGLPSSNPEP 317
            :||||..|.|..|.|.:       |:|.......|||  |:.||    |..:  ..|.|:..|..
 Frog    18 NYLSTTCPGLHTLTDVVRTSLRDHFTHPTESGGSRGNKRRYFGLDSYHPPPL--PPGTPAPPPHT 80

  Fly   318 NFIAIQITAEVDFTLDITYQS---------TSGFSLGESIPKPPTGRAYQDSLQAKIAQFEQRFE 373
            ..:..|:|.::.|..::.::|         .||.|||..:.:..|             ..|.||:
 Frog    81 QLVVHQLTLQLPFQAEVLFESGSFQQRPGQLSGVSLGTELDRHKT-------------NMENRFQ 132

  Fly   374 DRFQLKQKGHSPEEVRFARNALSNLLGGIGYFYGSSRVQSVYTKNPVPYWKAPLYTAVPSRSFFP 438
            ..|:|::||.:|::|.||:.||||:|||:|||||||.|:|.:...||.|..||||||||||||||
 Frog   133 SIFRLEEKGFTPDQVAFAQAALSNMLGGMGYFYGSSVVKSPHNAEPVLYPAAPLYTAVPSRSFFP 197

  Fly   439 RGFLWDEGFHGLLISAWDIDIELDIICHWFDLLNVEGWIPREQILGVEALAKVPEEFVTQRNSNA 503
            ||||||||||.|||..|:..:....:.||.||:|.:||||||||||.||.:|||:|||.|::.||
 Frog   198 RGFLWDEGFHLLLIGRWNPSLAWQSLGHWLDLMNADGWIPREQILGSEARSKVPDEFVIQKSENA 262

  Fly   504 NPPTFFLTLKKLLTSHRAELSQNGRLATLERLYPRVQAWFNWFNTTQRGEVLGTYLWRGRNATTT 568
            ||||.||.|::||.:...:       ..|.|.:||:|.|::|:|:||.|.:..||.||||:....
 Frog   263 NPPTLFLALRQLLANTEGD-------EALRRAWPRLQTWYDWYNSTQAGLLPHTYRWRGRDQDPL 320

  Fly   569 RELNPKSLSSGLDDYPRASHPTDKERHLDLRCWIALAAGVMAELSTLLGKDDAKYYETASYLTDN 633
            |.||||:|:||||||||||||:::|||:|||||:|||:.|||:::..|.:|..:|....:.||||
 Frog   321 RFLNPKTLTSGLDDYPRASHPSEEERHVDLRCWMALASQVMADIAERLEEDGGRYRHDHNILTDN 385

  Fly   634 VRLNRLHLAPYSEQYADWGLHTDQVKLK--RPPSMAPQQQQRHHHQHYQLPEMQRVTGELPTYQF 696
            ..|:..|.:.....|||:|.||....|:  ||.: ||.|..|    ....|::.||..:.|..|:
 Frog   386 ALLDHHHWSERLGAYADYGNHTQNTALEWVRPRA-APGQDPR----SVPPPQLIRVVRKPPRLQY 445

  Fly   697 VDSAFGYVSLFPLLLEQLDHDSPYLTKLLNDLRDPEQLWTNYGLRSLSKRSPLYMQRNTEHDPPY 761
            | .|.|||||||.||:.||..:|:|.:||:.:||.::|||.||:|||||.||||:|||||||.||
 Frog   446 V-GALGYVSLFPFLLQVLDPSAPHLGRLLDLIRDADKLWTPYGIRSLSKGSPLYLQRNTEHDAPY 509

  Fly   762 WRGPIWININYLAAKALHHYGKIDGPNAALARQIYAELRDNLVGNILRQYKRSGYLWEQYDDTSG 826
            ||||||||:|||..:||:.|.:::||:......:|.|||.||:.|:.||||.:|:|||||:|.:|
 Frog   510 WRGPIWINMNYLTVRALYLYSQMEGPHRDRLVSLYRELRQNLLANLYRQYKNTGFLWEQYNDQTG 574

  Fly   827 EGKGCNPFTGWTATVVLLMAEQF 849
            :|:||.|||||::.:||:|||::
 Frog   575 QGQGCFPFTGWSSLLVLIMAEEY 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 8/24 (33%)
Glyco_hydro_63 352..847 CDD:281228 259/497 (52%)
mogsXP_004911601.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332872092
eggNOG 1 0.900 E1_KOG2161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D162821at33208
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.