DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and mogs

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001073659.1 Gene:mogs ZFINID:ZDB-GENE-070112-412 Length:841 Species:Danio rerio

Alignment Length:824 Identity:376/825 (46%)
Similarity:503/825 (61%) Gaps:45/825 (5%)


  Fly    57 KWKTMIGCV--------CLAIASYFGYLGYLET----RVNTPFDHQKMVVHAGLE----QPDRYW 105
            |.||.||.|        |:....:|.|..|:.:    ||.| ......|:.|...    .|:|||
Zfish    32 KKKTDIGKVFINISIGLCIFSLIWFFYALYMRSSLARRVVT-LHPSPRVLDANSSSPAVSPERYW 95

  Fly   106 GSYRPLTYFGMKTRDPHSLVMGLMWYTPSNLGPGGQGIRHWCEQGDKLDSYGWTHHDGRSFGVQE 170
            |||||..|||||||.|.|:|.||||.  .........:||.|||||.|..|||..|||.||||||
Zfish    96 GSYRPQVYFGMKTRSPRSVVTGLMWM--HQFAEMDGNLRHTCEQGDHLLGYGWLMHDGVSFGVQE 158

  Fly   171 IQDLPFELKTSFVKYPEGKQYGGDWTARISVR-NTTRAWDKSISLIWYVALDERTNGHIKYVSDD 234
            |.|..|.|.|.||| ..|..:|||||.||:.: :.|......:||::|.:.|.:  |.::...::
Zfish   159 IHDRDFTLTTEFVK-RMGGDHGGDWTWRITAKQHGTALSTPVVSLMFYASTDGQ--GSLQAHVEE 220

  Fly   235 KSPEPGVYGEAQGLGEFQVRF------HAVKGKILHKSYLSTVAPSLAKLKDTL---FSHFRAFA 290
            |:....|.|.::.||.|::.|      .....|....::|.|.:|.|.||.|.:   .:|...|:
Zfish   221 KNRVSSVTGTSEELGNFKITFGKPTAGEGASAKYARYNFLQTRSPGLDKLTDIVKNSLNHKFIFS 285

  Fly   291 DKRGNR--FIGLPGEIVSQNGLPSSNP--EPNFIAIQITAEVDFTLDITYQSTSGFSLGESIPKP 351
            ..:|.:  :..:....|:.:....::|  |.:|:..|:|.:..|.:::.::|.|    ....|..
Zfish   286 PPKGEKRSYFAVDSYKVTNHQNQQNDPKMESDFVVHQVTVQTPFQIEVLFESGS----FRERPNQ 346

  Fly   352 PTGRAYQDSLQAKIAQFEQRFEDRFQLKQKGHSPEEVRFARNALSNLLGGIGYFYGSSRVQSVYT 416
            ..|....|.|:.:...|:::||..|.|:.||.:...::||:.||||:|||:|||:|.|.|||||.
Zfish   347 LVGSVLTDELEKRKVAFDEKFEATFGLQAKGFTSSHIKFAKAALSNMLGGMGYFFGPSVVQSVYN 411

  Fly   417 KNPVPYWKAPLYTAVPSRSFFPRGFLWDEGFHGLLISAWDIDIELDIICHWFDLLNVEGWIPREQ 481
            ::||.|.:.||:||||||||||||||||||||.||:|.||..:..::..||.||:|:||||||||
Zfish   412 EHPVLYPEGPLFTAVPSRSFFPRGFLWDEGFHQLLLSKWDTQLTQEVFAHWLDLINIEGWIPREQ 476

  Fly   482 ILGVEALAKVPEEFVTQRNSNANPPTFFLTLKKLLTSHRAEL-SQNGRLATLERLYPRVQAWFNW 545
            ||..||.:|||.||:.|.|.||||||.||.|::||....||| |....|..|.:||||:|.||.|
Zfish   477 ILDDEARSKVPSEFIVQHNENANPPTLFLALQELLEQLDAELVSSQTMLPFLRKLYPRLQVWFEW 541

  Fly   546 FNTTQRGEVLGTYLWRGRNATTTRELNPKSLSSGLDDYPRASHPTDKERHLDLRCWIALAAGVMA 610
            |||||.|.|..:|.||||:..|...||||:|:||||||||||||:..|||:||.||:.||:||||
Zfish   542 FNTTQVGPVPNSYRWRGRDKDTNLFLNPKTLTSGLDDYPRASHPSADERHVDLYCWMTLASGVMA 606

  Fly   611 ELSTLLGKDDAKYYETASYLTDNVRLNRLHLAPYSEQYADWGLHTDQVKLKRPPSMAPQQQQRHH 675
            .::.:||:....|..|...|::|..||.||.:.....::|:|.||..|.|::.....|..|.|| 
Zfish   607 NVARILGEPHQLYENTHRSLSNNDLLNELHWSENLHAFSDYGNHTQAVSLQQEKVFVPPGQPRH- 670

  Fly   676 HQHYQLPEMQRVTGELPTYQFVDSAFGYVSLFPLLLEQLDHDSPYLTKLLNDLRDPEQLWTNYGL 740
              .:.:..:.|.....|..|:| :|.|||||||.||..|..|||.:..:|..::|||:|||.|||
Zfish   671 --QFPVARLVRSVRRAPKLQYV-NALGYVSLFPFLLHILTPDSPKIEHILQAIKDPERLWTPYGL 732

  Fly   741 RSLSKRSPLYMQRNTEHDPPYWRGPIWININYLAAKALHHYGKIDGPNAALARQIYAELRDNLVG 805
            ||||:..||||:||||||.|||||||||||||||.:||||||.|:||....|..:|.|||.||:.
Zfish   733 RSLSRADPLYMKRNTEHDAPYWRGPIWININYLAVRALHHYGSIEGPYKEKAATLYQELRTNLMN 797

  Fly   806 NILRQYKRSGYLWEQYDDTSGEGKGCNPFTGWTATVVLLMAEQF 849
            |:.:||..:||:||||:|::|.|:|.:|||||:|..||:|||::
Zfish   798 NVYKQYLETGYIWEQYNDSTGRGQGSHPFTGWSALTVLIMAEKY 841

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 78/189 (41%)
Glyco_hydro_63 352..847 CDD:281228 267/496 (54%)
mogsNP_001073659.1 Glyco_hydro_63N 94..>241 CDD:293528 69/152 (45%)
Glyco_hydro_63 347..839 CDD:281228 267/496 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332864029
eggNOG 1 0.900 E1_KOG2161
Hieranoid 1 1.000
Homologene 1 1.000 H4593
Inparanoid 1 1.050 699 1.000 Inparanoid score I636
OMA 1 1.010
OrthoDB 1 1.010 D162821at33208
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 1 1.000 T1054435
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 LDO PTHR10412
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R480
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.