DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and SPAC6G10.09

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_594106.1 Gene:SPAC6G10.09 PomBaseID:SPAC6G10.09 Length:808 Species:Schizosaccharomyces pombe

Alignment Length:899 Identity:276/900 (31%)
Similarity:403/900 (45%) Gaps:227/900 (25%)


  Fly    73 FGYLGYLETRVNTPFDHQKMVVHAGLEQPDR------YWGSYRPLTYFGMKTRDPHSLVMGLMWY 131
            ||.|.:|...|         :|...:|..::      .||.|||..|.|::.:.|.||:.|||| 
pombe    15 FGLLSFLLNCV---------LVSCSVEDIEKAANDSFLWGPYRPNLYVGIRPKIPDSLMTGLMW- 69

  Fly   132 TPSNLGPGGQ--GIRHWCEQGDKLDSYGWTHHDGRSFGVQEIQD--LPFELKTSFVKYPEGKQYG 192
              ||:....:  .:||..|.||.:.::||.|:|.|..|.|.|.|  :..:|:|.|||.||     
pombe    70 --SNVDDYARFSKMRHSAEHGDDIGAFGWKHYDVRRGGQQVIDDFLMGIKLETDFVKLPE----- 127

  Fly   193 GDWTARI-SVRNTTRAWDKSISLIWYVALD------ERTNGHIKYV-SDDKSPEPGVYGEAQGLG 249
            |:|..|: .:.......|.:.||.:|..::      .:.| |..:| .:.|:|:         ||
pombe   128 GNWALRVHGIPLPGAPTDLTTSLFFYAYVEGEGKVGTKVN-HANHVYMEGKTPD---------LG 182

  Fly   250 EFQVRF------HAV-------KGKILHKSYLS----------TVAPSLAKLKDTLFSHFRAFAD 291
            :|:::.      |.|       :..::.|.:.:          ..:..:..|.||   ..:..:|
pombe   183 KFRIQTFNRLGEHPVSPASVDLESMVMDKDFFAGFNVKKEGAWRTSELILYLLDT---KMKVISD 244

  Fly   292 KRGNRFI-GLPGEIVSQNGLPSSNPEPNFIAIQITAEVDFTLDITYQSTSGFSLGESIPKPPTGR 355
            |.|...: .|| ...|...||:...|.....||...:.:|..||.:...|...:.|.:    ..:
pombe   245 KEGYESLKDLP-PAYSTLTLPNLPSEEGLQFIQKVFKGEFMFDIVFNYASSKKISEEM----ISQ 304

  Fly   356 AYQDSLQAKIAQFEQRFEDRFQLK-----QKGHSPEEVRFARNALSNLLGGIGYFYGSSRVQSVY 415
            |...:||    :||::|:..|.||     :|.|.    .||..|.|||.|.:|:|.|    .|:.
pombe   305 AIDKNLQ----EFEEKFQATFPLKAPYDTEKAHQ----IFAHTAFSNLFGNVGFFTG----DSIV 357

  Fly   416 TKNPVPY--------------------------WKAPLYTAVPSRSFFPRGFLWDEGFHGLLISA 454
            :|||:..                          .:..|:|.||||..|||||.||||||.|.:..
pombe   358 SKNPIELDDEDYEFMQGFESAAGKLAEGTAFHDIERSLFTIVPSRPHFPRGFYWDEGFHLLPVGL 422

  Fly   455 WDIDIELDIICHWFDLLNVEGWIPREQILGVEALAKVPEEFVTQRNSNANPPTFFLTLKKLLTSH 519
            ||.|..|:|:..||.|:|.:||:.||||||.||.:|||:||.||....|||||..|.||..:  .
pombe   423 WDNDFSLEILKSWFSLVNEDGWVGREQILGEEARSKVPDEFQTQYPDIANPPTLILALKGYI--E 485

  Fly   520 RAELSQNGRLAT-------------------------------LERLYPRVQAWFNWFNTTQRG- 552
            |.: .|.|:|..                               |..|:|.:...:.||..||:| 
pombe   486 RLQ-EQQGKLNNRFSGEGEDYSLDDLEYLRSVSISNPEKSVQFLRDLFPLLLRHYEWFRETQKGD 549

  Fly   553 ----------EVLGTYLWRGRNATTTRELNPKSLSSGLDDYPRASHPTDKERHLDLRCWIALAAG 607
                      :|.| |.||||.       ....|:|||||||||..|:..|.|:||..|:.....
pombe   550 FETWERECFSQVEG-YRWRGRT-------YQHCLASGLDDYPRAQPPSTAELHVDLLSWMTSFTR 606

  Fly   608 VMAELSTLLGK-DDAKYYETASYLTDNVRLNRLHLAPYSEQ---YADWGL--HTDQVKLKRPPSM 666
            .:..::..||: ::|:  :.|.|  :|..|..|....:.|:   |.|..:  :.|.:.:      
pombe   607 SLHFVAEFLGETEEAE--KLAGY--ENAMLRNLEDNHWDEEVQAYCDSSVDEYDDPINV------ 661

  Fly   667 APQQQQRHHHQHYQLPEMQRVTGELPTYQFVDSAFGYVSLFPLLLEQLDHDSPYLTKLLNDLRDP 731
                    .|:                        |||:|.|::|..|..||..||.||..:||.
pombe   662 --------CHK------------------------GYVTLLPMMLGLLPADSGRLTSLLKLIRDE 694

  Fly   732 EQLWTNYGLRSLSKRSPLYMQRNTEHDPPYWRGPIWININYLAAKALH-HYGKIDGPNAALARQI 795
            .:||:.||:||||.....:   .|..:  |||||||||:|||...:|: :|....|||..|||.|
pombe   695 NELWSPYGIRSLSMNDVYF---GTGEN--YWRGPIWINMNYLILSSLYQNYINTPGPNQNLARSI 754

  Fly   796 YAELRDNLVGNILRQYKRSGYLWEQYDDTSGEGKGCNPFTGWTATVVLLMAEQF 849
            |.|||.|:|.|:...::::|..|||||.|:|:|:....|||||:.||.:|:|.:
pombe   755 YEELRTNVVNNVFENWRQTGIFWEQYDPTTGKGQRTKDFTGWTSLVVNIMSENY 808

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 58/214 (27%)
Glyco_hydro_63 352..847 CDD:281228 194/575 (34%)
SPAC6G10.09NP_594106.1 Glyco_hydro_63N 43..251 CDD:293528 61/229 (27%)
Glyco_hydro_63 297..806 CDD:281228 195/583 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 333 1.000 Inparanoid score I503
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 1 1.000 T1125815
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 LDO PTHR10412
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R480
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.