DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and R03E9.2

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_509135.3 Gene:R03E9.2 WormBaseID:WBGene00019843 Length:619 Species:Caenorhabditis elegans

Alignment Length:553 Identity:103/554 (19%)
Similarity:189/554 (34%) Gaps:186/554 (34%)


  Fly   376 FQLKQKGHS--PEEVRFARNAL-------------SNLLGGIGYFY------------------- 406
            |.:::.|.:  |.::....|.:             :.|:.||.||:                   
 Worm   122 FSIEKNGTTILPNQLETIENGIPVVFNGGKLTFKYNQLIVGINYFFHANSSITVVIDSLGSAPNR 186

  Fly   407 GSSRVQSVYTKNPVPYWKAPLYTAVPSRSFFPRGFLWDEGFHGLLISAWDIDIELDIICH-WFDL 470
            .|..:..|.::......|.||.:.  ||.:|  .|..:.|  ....|..|||.::..|.: |.|.
 Worm   187 SSDNLTVVISQGDDQILKIPLKSG--SRKYF--SFPSENG--TAFSSEKDIDTQIKSIANSWLDG 245

  Fly   471 LNVEGWIPREQILGVEALAKVPEEFVTQRNSNANPPTFFLTLKKLLTSHRAELSQNGRLATLERL 535
            :|:                .||:||                |::|..::         |..:|..
 Worm   246 VNI----------------LVPKEF----------------LERLPKAY---------LEIMEYA 269

  Fly   536 YPRVQAWFNWFNTTQRGEVLGTYLWRGRNATTTREL-NPKSLSSGLDDYPRASHPTD---KERHL 596
            |..|.   |..|.....:::|.|    .|.|..:.: ..:|.:.|...:.....|..   |..|:
 Worm   270 YAYVA---NSLNFIPSAKLIGQY----ENFTVDQTMFFIQSRNEGFTSFDDQVFPLMTLLKLNHI 327

  Fly   597 D----LRCWIAL------------AAGVMAE--------------LST---LLGKDDAKYYETAS 628
            |    |..|::.            .||::.|              |||   ::.||: ::.|...
 Worm   328 DTLNILNSWMSTINELGYMGNRFSEAGIVLEKIQSPLLFQLVKEALSTQPKIITKDN-QFIEKLE 391

  Fly   629 YLTDNVRLNRLHLAPYSEQYADWGLHTDQVKLKRPPSMAPQQ----------------------- 670
            |:.:|...|  .:.|.......|..|:..:....|.:...:.                       
 Worm   392 YIAENTWKN--SIGPGRLLDVKWMGHSRGIFQLEPATKTGESSFELFCLIGDMCRIMNKVYERVD 454

  Fly   671 ------QQRHHHQHYQLP-----EMQRVTGELPTYQFVDSAFGYVSLFPLLLEQLDHDSPYLTKL 724
                  |||:......||     |:|:. |:|.|.:|..::..:..:...|:.:...|   ||:.
 Worm   455 EYDSKWQQRYLDFEAALPKYWNKELQQY-GDLETGKFKPNSSSHALITLSLVNETSED---LTRF 515

  Fly   725 LNDLRDPEQLWTNYGLRSLSKRSPLYMQRNTEHDPPYWRGPIWININYLAAKALHHYGKIDGPNA 789
            |.::    |...|:        :||.:|.:.:..       :.::.|||..::|..|.....|..
 Worm   516 LQNI----QTDNNF--------TPLGLQMSEDDG-------VSVSANYLLLRSLQFYALQSSPAQ 561

  Fly   790 ALARQIYAELRDNLVGNILRQYKRSGYLWEQYD 822
            .::.|:|:.|::||...|.|.|:.....:.::|
 Worm   562 EMSLQMYSILKNNLAAAIARAYRPEKIFYGKFD 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528
Glyco_hydro_63 352..847 CDD:281228 103/554 (19%)
R03E9.2NP_509135.3 Trehalase <435..616 CDD:302639 36/184 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.