DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and mogs-1

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001076681.1 Gene:mogs-1 WormBaseID:WBGene00008775 Length:796 Species:Caenorhabditis elegans

Alignment Length:808 Identity:304/809 (38%)
Similarity:444/809 (55%) Gaps:90/809 (11%)


  Fly    61 MIGCVCLAIASYFGYLGYLETRVNTPFDHQKMVVHAGLEQPDRYWGSYRPLTYFGMKTRDPHSLV 125
            |:|..|..:...:.|.. ||.....|        :...|.....||:|||..|||::||.|.|.:
 Worm    54 MLGAGCFILLHLYLYPN-LEKVAPLP--------NIDPENAPYTWGTYRPHMYFGLRTRSPMSPL 109

  Fly   126 MGLMWYTPSNL--GPGGQGIRHWCEQGDKLDSYGWTHHDGRSFGVQEIQDL-PFELKTSFVKYPE 187
            .|:|||...|.  .|   .|||||.|.|:|..|.|...|||.||.|.|.:. ...::|.::....
 Worm   110 FGMMWYEQPNTIQRP---HIRHWCNQDDRLPGYYWYEADGRHFGKQNISEAHKGVIQTDWINDAN 171

  Fly   188 GKQYGGDWTARISVRNTTRAWDKSISLIWYVALDE-----RTNGHIKYVSDDKSPEPGVYGEAQG 247
            |      :.||:.:   ..|..:..::|.|::..|     |...|:..|         .:|..:.
 Worm   172 G------FAARVKL---NMAPGRRYNVILYLSAQEIGTRFRLGKHLSDV---------FHGYNEL 218

  Fly   248 LGEFQVRFHA---VKGKILHKSYLSTVAPSLAKLKDTLFSHFRAFADKRGNRFIGLPGE----IV 305
            ||:|.:....   .|.:..|...|:.....:.:..|.:..:.:|:         ..|.:    |:
 Worm   219 LGKFTMSLRLKDNTKLQTSHSVMLTDEKIPIDRYHDFVVDNTQAY---------NAPNQPLNYIL 274

  Fly   306 SQNGLPSSNPEPNFIAIQIT--AEVDFTLDITYQSTSGFSLGESIPKPPTGRAYQDSLQAKIAQF 368
            ::.   .::.|..|||:|:.  ::.:|.:.:..:...|.       ||   ..:.:.|:.:...|
 Worm   275 NEK---HNDEEGKFIAVQLNLGSQAEFDIILQTEKLKGM-------KP---EEFTNILRIRSYNF 326

  Fly   369 EQRFEDRFQLKQKGHSPEEVRFARNALSNLLGGIGYFYGSSRVQSVYTKNPVPYWKAPLYTAVPS 433
            .:::|:.|||..|.::..:::.|:.:|||:||.:||:||.:||  ::.....||....|::||||
 Worm   327 NKKYENVFQLAGKNYTKTQLKMAKVSLSNMLGSVGYWYGHNRV--LFNGIVQPYGPHVLFSAVPS 389

  Fly   434 RSFFPRGFLWDEGFHGLLISAWDIDIELDIICHWFDLLNVEGWIPREQILGVEALAKVPEEFVTQ 498
            |.|||||||||||||.:||...|..:.|:.|..|.:.::..||||||.|:|.||.||||.||:.|
 Worm   390 RPFFPRGFLWDEGFHQMLIRKMDSKMTLEAIASWMNAMDTSGWIPREMIVGSEAEAKVPAEFIPQ 454

  Fly   499 RNSNANPPTFFLTLKKLLTSHRAELSQNGRLA-TLERLYPRVQAWFNWFNTTQRGEVLGTYLWRG 562
            :|..|||||.|..:.||:...:..    ||.| .|:.||||::.||:|...||.|....||.|||
 Worm   455 KNDVANPPTLFYVMDKLVNDEKTV----GRYAGILKLLYPRLEKWFHWIRITQSGPTRTTYRWRG 515

  Fly   563 RNATTTRELNPKSLSSGLDDYPRASHPTDKERHLDLRCWIALAAGVMAELSTLLGKDDAKYYETA 627
            ||.|...|||||:|||||||:||||||:|.|.|||||||:|||:.|:..|:...| .||.|..||
 Worm   516 RNETIKTELNPKTLSSGLDDFPRASHPSDLEYHLDLRCWLALASRVLNRLAKSYG-TDADYQRTA 579

  Fly   628 SYLTDNVRLNRL---HLAPYSEQYADWGLHTDQVKLKRPPSMAPQQQQRHHHQHYQLPEMQRVTG 689
            ..:.:....:.|   |.:..::.:.|:|.|:..|.|...|:....:|.          |.||||.
 Worm   580 KAMEELNNFDSLVKDHWSEEAQGFFDYGKHSFDVALSPVPTPGSPRQF----------EYQRVTS 634

  Fly   690 ELPTYQFVDSAFGYVSLFPLLLEQLDHDSPYLTKLLNDLRDPEQLWTNYGLRSLSKRSPLYMQRN 754
            ..|:|..|..||||.:|||::|:.:...||.|..:|:.:|||:.|||||||||:|:.||.||.||
 Worm   635 RAPSYTLVSDAFGYNNLFPMMLKLIPSKSPILKSMLDKIRDPKILWTNYGLRSISRSSPYYMARN 699

  Fly   755 TEHDPPYWRGPIWININYLAAKALHHYGKIDGPNAALARQIYAELRDNLVGNILRQYKRSGYLWE 819
            ||||||||||.||||:||:...:|.||....||....|..|::|||.|||.|:..|::::|:|||
 Worm   700 TEHDPPYWRGYIWINVNYMVLSSLRHYADQPGPYRENAENIFSELRANLVKNLATQFQKTGFLWE 764

  Fly   820 QYDDTSGEGKGCNPFTGWTATVVLLMAE 847
            .|||.:|||:||:|||||::.::|:|::
 Worm   765 NYDDRTGEGRGCHPFTGWSSLILLIMSD 792

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 54/190 (28%)
Glyco_hydro_63 352..847 CDD:281228 230/499 (46%)
mogs-1NP_001076681.1 Glyco_hydro_63N 89..253 CDD:293528 53/185 (29%)
Glyco_hydro_63 310..792 CDD:281228 232/509 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332399015
eggNOG 1 0.900 E1_KOG2161
Hieranoid 1 1.000
Homologene 1 1.000 H4593
Inparanoid 1 1.050 520 1.000 Inparanoid score I682
Isobase 1 0.950 0 Normalized mean entropy S1986
OMA 1 1.010
OrthoDB 1 1.010 D162821at33208
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 1 1.000 T476797
orthoMCL 1 0.900 OOG5_129620
Panther 1 1.100 LDO PTHR10412
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R480
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.