DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GCS1 and LOC103692171

Sequence 1:NP_001245621.1 Gene:GCS1 FlyBaseID:FBgn0030289 Length:849 Species:Drosophila melanogaster
Sequence 2:XP_008761308.1 Gene:LOC103692171 RGDID:9236907 Length:834 Species:Rattus norvegicus

Alignment Length:887 Identity:362/888 (41%)
Similarity:477/888 (54%) Gaps:113/888 (13%)


  Fly     2 ARNTGSSSGSTPAASSSGSSAAAAAAAAAAAAAASNAKQKQRSPRFSLSSNLILDKWKTMIGCVC 66
            ||..|...|.  |..:.||:..||.|....|.|            |.||...:| .|..:...:.
  Rat    22 ARGAGRRDGR--AGGARGSAGGAALAVVVLALA------------FGLSGRWVL-AWLRVRRALT 71

  Fly    67 LAIASYFGYLGYLETRVNTPFDHQKMVVHAGLEQPDRYWGSYRPLTYFGMKTRDPHSLVMGLMWY 131
            |..|.           ...|.|.....|     .|:.:||:|||..|||||||.|..|:.||||.
  Rat    72 LHPAP-----------SALPPDSSSPAV-----APELFWGTYRPHVYFGMKTRSPKPLLTGLMWA 120

  Fly   132 -------TPSNLGPGGQGIRHWCEQGDKLDSYGWTHHDGRSFGVQEIQDLPFELKTSFVKYPEGK 189
                   ||..|       ||.|||||.:..|||..|||.|||.|.|.|....|.|.||| ..|.
  Rat   121 QQGATPGTPPKL-------RHTCEQGDGVGPYGWEFHDGLSFGRQHIYDGALRLTTEFVK-RSGG 177

  Fly   190 QYGGDWTARISVRNTTRAWDK--SISLIWYVALDER--------TNGHIKYVSDDKSPEPGVYGE 244
            .:||||:.|::|.........  .:||.:||..|.:        ..|.:|::|          |.
  Rat   178 HHGGDWSWRVTVEPQASGTPSFPLVSLFFYVVTDGQEVLLPEVGAKGQLKFIS----------GH 232

  Fly   245 AQGLGEFQVRF--HAVKGKIL--HKSY--LSTVAPSLAKLKDTLFSHFRAFADKR-----GNRFI 298
            ...||:|::..  ....|..:  |.||  ..:..|.|..|.|.:.||..::...|     ..|::
  Rat   233 TSELGDFRLTLLPPTTPGDTVPKHGSYNVFWSSNPGLPLLTDMVKSHLNSWFHHRPPGASPERYL 297

  Fly   299 GLPGEIVSQNGLPSSNPEPNFIAIQITAEVDFTLDITYQSTSGFSLGESIPKPPTGRAYQDSLQA 363
            ||||.:..:...||.  :..|:..|:|.:..|:::..::|.|..:..:...:...|.....:|::
  Rat   298 GLPGSLKWEERGPSG--QGQFLVQQVTLKAPFSVEFVFESGSARTGRDQASEQLVGGQLTRALES 360

  Fly   364 KIAQFEQRFEDRFQLKQKGHSPEEVRFARNALSNLLGGIGYFYGSSRV-------QSVYTKNPVP 421
            ..|.|::|||..||||:||.||||....:.|||.||||||||||...|       .|....:|..
  Rat   361 HAAAFKERFERTFQLKEKGLSPEEQALGQVALSGLLGGIGYFYGQGLVLPDTGMEGSEQKMDPSL 425

  Fly   422 YWKAPLYTAVPSRSFFPRGFLWDEGFHGLLISAWDIDIELDIICHWFDLLNVEGWIPREQILGVE 486
            :...||::.||||||||||||||||||.|::..||..:..:.:.||..|||.:|||.||||||.|
  Rat   426 FPPVPLFSGVPSRSFFPRGFLWDEGFHQLVVQRWDPHLTREALGHWLGLLNADGWIGREQILGDE 490

  Fly   487 ALAKVPEEFVTQRNSNANPPTFFLTLKKLLTSHRAELSQNGRLATLERLYPRVQAWFNWFNTTQR 551
            |.|:||.||:.||.::|||||..|.:..:|.....|     .||.|.|.:||:.|||:|.:.:|.
  Rat   491 ARARVPPEFLVQRAAHANPPTLLLPVIHMLEGRAPE-----DLAFLRRAFPRLHAWFSWLHQSQA 550

  Fly   552 GEVLGTYLWRGRNATTTRELNPKSLSSGLDDYPRASHPTDKERHLDLRCWIALAAGVMAELSTLL 616
            |.|..:|.||||:......||||:|.||||||||||||:..|||||||||:.|.|.|:::|:..|
  Rat   551 GPVPLSYRWRGRDLALPTLLNPKTLPSGLDDYPRASHPSAAERHLDLRCWVTLGARVLSQLAEEL 615

  Fly   617 GKDD--AKYYETASYLTDNVRLNRLHLAPYSEQYADWGLHTDQVKLK-RPPSMAPQQQQRHHHQH 678
            |:.:  |:....|:.|.....|:.||.||....:||:|.||..|:|| |||.             
  Rat   616 GETEAAAELGPLAASLEAAGSLDELHWAPELGVFADFGNHTKAVQLKSRPPQ------------- 667

  Fly   679 YQLPEMQRVTGE-LPTYQFVDSAFGYVSLFPLLLEQLDHDSPYLTKLLNDLRDPEQLWTNYGLRS 742
                .:.||.|. .|..|:|| |.||||||||||:.|:..||.|..||:.|.|...||:.:||||
  Rat   668 ----GLVRVVGRPPPRLQYVD-ALGYVSLFPLLLQLLEPSSPRLGPLLDVLADSRHLWSPFGLRS 727

  Fly   743 LSKRSPLYMQRNTEHDPPYWRGPIWININYLAAKALHHYGKIDGPNAALARQIYAELRDNLVGNI 807
            ||..|..|.|||||||||||||.:|:||||||..||||||:::||:...|.::|.|||.|:|.|:
  Rat   728 LSASSLFYKQRNTEHDPPYWRGAVWLNINYLALGALHHYGRVEGPHKVQAAKLYRELRANVVSNV 792

  Fly   808 LRQYKRSGYLWEQYDDTSGEGKGCNPFTGWTATVVLLMAEQF 849
            .:||:.:|:|||||.|..|.|.||.||.|||:.|:|:|||::
  Rat   793 RQQYQATGFLWEQYSDQDGRGMGCRPFQGWTSLVLLIMAEEY 834

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GCS1NP_001245621.1 Glyco_hydro_63N 104..283 CDD:293528 72/202 (36%)
Glyco_hydro_63 352..847 CDD:281228 250/506 (49%)
LOC103692171XP_008761308.1 Glyco_hydro_63N 92..284 CDD:293528 74/210 (35%)
Glyco_hydro_63 349..832 CDD:281228 250/506 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332870900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D162821at33208
OrthoFinder 1 1.000 FOG0003402
OrthoInspector 1 1.000 T619143
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.