DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and gpat4

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001035339.2 Gene:gpat4 / 678522 ZFINID:ZDB-GENE-060421-5102 Length:451 Species:Danio rerio


Alignment Length:262 Identity:55/262 - (20%)
Similarity:91/262 - (34%) Gaps:106/262 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLW------LYRFLTPLIVTFLLPLVFVALIYISFLVLF------------IYKLHRQVIMRAVQ 70
            :||      .|.||.||.||.....|.:.::..|.:.||            ::.:..::.:||  
Zfish   157 ALWGVGVLIRYGFLLPLRVTLAFTGVGLLVVLTSIVGLFPNGRMKNYLSDKVHLMCYRICVRA-- 219

  Fly    71 GDRNFWRVGRKIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQR 135
                       :.|.|      .||     ..||.|:.| .:.|..|.: |||:      ::|..
Zfish   220 -----------LTAII------TYH-----DSENKPKNG-GICVANHTS-PIDV------IILAS 254

  Fly   136 ERLIYTIGDRFLFKLPG--WGTISEAFHVSPGTVQSCVSI------LRDGNLLAISPGGVYEAQF 192
            :.....:|     ::.|  .|.|..|.      |::|..|      ::|.:|:|        .:.
Zfish   255 DGCYAMVG-----QVHGGLMGVIQRAM------VKACPHIWFERSEVKDRHLVA--------KRL 300

  Fly   193 GDHYYELLWRNRVGFAKVAIEAKAPII-----PCFTQNLREGFRQVGIFRTFFMRLYNKVRIPVY 252
            .||              ||.|:|.||:     .|........|:: |.|         ::...||
Zfish   301 SDH--------------VADESKLPILIFPEGTCINNTSVMMFKK-GSF---------EIGCTVY 341

  Fly   253 PI 254
            |:
Zfish   342 PV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 45/233 (19%)
LPLAT_MGAT-like 90..298 CDD:153249 38/178 (21%)
gpat4NP_001035339.2 LPLAT_LPCAT1-like 213..422 CDD:153253 42/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.