DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and lpcat2

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001018492.1 Gene:lpcat2 / 553683 ZFINID:ZDB-GENE-050522-229 Length:529 Species:Danio rerio


Alignment Length:265 Identity:58/265 - (21%)
Similarity:97/265 - (36%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LHSLLSSYIDLDYSLWLYRFLTPLIVTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNF 75
            :|.|..|..|:.....|...|.||...||| ||.:.:..:|.::.|...|  :.::..:.|.|.|
Zfish    26 VHDLSLSTADITKCFLLGIILVPLRAIFLL-LVLLVMWPVSVIITFGQSL--KGVVEPMTGWRRF 87

  Fly    76 WRVGRKIVAAIWDAHARIYH---GYEVI--GLENVPQEGPALIVYYHGAIPIDMYYLNSRM---L 132
              :.|:::..:    .|:|.   |::|:  |.:....|.|.|.|..|.:....:..:.|.:   :
Zfish    88 --LHRRVMTFL----GRMYFFGMGFKVVVKGKKASTLEAPILAVAPHSSFFDAIACIESGLPSTV 146

  Fly   133 LQRERLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGNLLAISPGGVYEAQFGDHYY 197
            .:.|.|...|..|||            ..|.|..|.......|...::.|.    ..|:.|.|:.
Zfish   147 SRIESLEAPIFGRFL------------RCVQPVLVSRTDPDSRRNTIIEIE----RRAKSGGHWP 195

  Fly   198 ELLWRNRVGFAKVAIEAKAPIIP---CFTQNLREGFRQVGIFRTFFMRLYNKVRIPVYPIYGGFP 259
            ::|                 |.|   |..::....|:|.|..          ..:||.|:...:|
Zfish   196 QVL-----------------IFPEGTCTNRSCLITFKQGGFV----------PGVPVQPVLIRYP 233

  Fly   260 VKFRT 264
            .|..|
Zfish   234 NKLDT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 45/229 (20%)
LPLAT_MGAT-like 90..298 CDD:153249 38/186 (20%)
lpcat2NP_001018492.1 PlsC 49..297 CDD:223282 51/242 (21%)
LPLAT_LPCAT1-like 98..309 CDD:153253 38/184 (21%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 128..133 1/4 (25%)
EGTC motif 202..205 0/2 (0%)
EFh 316..406 CDD:298682
EFh 378..440 CDD:238008
EF-hand_7 378..435 CDD:290234
EF-hand_7 415..473 CDD:290234
EFh 418..473 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.