| Sequence 1: | NP_001096954.1 | Gene: | CG34348 / 32072 | FlyBaseID: | FBgn0085377 | Length: | 323 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_998157.1 | Gene: | agpat4 / 406265 | ZFINID: | ZDB-GENE-040426-1924 | Length: | 377 | Species: | Danio rerio | 
| Alignment Length: | 332 | Identity: | 62/332 - (18%) | 
|---|---|---|---|
| Similarity: | 111/332 - (33%) | Gaps: | 125/332 - (37%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    29 RFLTPLIVTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRVGRKIVAAI--WD-AH 90 
  Fly    91 ARIY---HGYEVIGLENVPQEGPALIVYYHGAIPIDMY----------YLNSRMLLQRERLIY-- 140 
  Fly   141 TIG-----------------DR----------------FLFKLPGWGT------------ISE-- 158 
  Fly   159 -----AFHVSPGTVQSCVSI--LRDGNLLAISPGGVYEAQF---------------GDHYYELLW 201 
  Fly   202 RNRVGFAKV---AIEAKAPIIPCFTQ--NLREGFRQVGIF--------RTFFMRLYNKVR----- 248 
  Fly   249 -IPVYPI 254  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG34348 | NP_001096954.1 | PlsC | 47..271 | CDD:223282 | 59/314 (19%) | 
| LPLAT_MGAT-like | 90..298 | CDD:153249 | 53/268 (20%) | ||
| agpat4 | NP_998157.1 | PLN02380 | 20..320 | CDD:178006 | 55/318 (17%) | 
| LPLAT_LCLAT1-like | 62..256 | CDD:153252 | 40/206 (19%) | ||
| Acyltransf_C | 243..314 | CDD:292694 | 15/74 (20%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||