DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and agpat4

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_998157.1 Gene:agpat4 / 406265 ZFINID:ZDB-GENE-040426-1924 Length:377 Species:Danio rerio


Alignment Length:332 Identity:62/332 - (18%)
Similarity:111/332 - (33%) Gaps:125/332 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RFLTPLIVTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRVGRKIVAAI--WD-AH 90
            :.|..||:.::..:..:.:..:....|.::.:::|:..:.  ..|..:.:..::||.:  |. ..
Zfish    10 QLLCHLIICYVFLVSGIIINLLQLCTLPLWPINKQLARKI--NCRLGYSIASQLVALLEWWSGTE 72

  Fly    91 ARIY---HGYEVIGLENVPQEGPALIVYYHGAIPIDMY----------YLNSRMLLQRERLIY-- 140
            ..:|   ..:.:.|.||      |::|..|. ..||..          .|.|..:|.::.|.:  
Zfish    73 CTLYTDPESFRLYGKEN------AIVVLNHN-FEIDFMTGWTFCERFGVLGSSKVLAKKELSFVP 130

  Fly   141 TIG-----------------DR----------------FLFKLPGWGT------------ISE-- 158
            .||                 ||                |.|.|...||            ::|  
Zfish   131 VIGWMWYFLEIVFCKRKWEEDRNTVVQSLRNLQDYPEFFWFLLHCEGTRFTEKKHKISMEVAEKK 195

  Fly   159 -----AFHVSPGTVQSCVSI--LRDGNLLAISPGGVYEAQF---------------GDHYYELLW 201
                 .:|:.|.|...||::  || |.:.|     ||::..               |..|:..|:
Zfish   196 GLPKLKYHLLPRTKGFCVTVQNLR-GKVTA-----VYDSTLNFRNNEMPTLLGVLNGKKYHADLY 254

  Fly   202 RNRVGFAKV---AIEAKAPIIPCFTQ--NLREGFRQVGIF--------RTFFMRLYNKVR----- 248
            ..|:....:   ..|..|.:...:.:  ..:|.:||.|.|        |    ||:..|.     
Zfish   255 VRRIPLDSIPEDESECAAWLHKLYQEKDEFQEHYRQTGRFPGPITNPPR----RLWALVNWLFWV 315

  Fly   249 -IPVYPI 254
             :.||||
Zfish   316 CVLVYPI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 59/314 (19%)
LPLAT_MGAT-like 90..298 CDD:153249 53/268 (20%)
agpat4NP_998157.1 PLN02380 20..320 CDD:178006 55/318 (17%)
LPLAT_LCLAT1-like 62..256 CDD:153252 40/206 (19%)
Acyltransf_C 243..314 CDD:292694 15/74 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.