DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and tmem68

DIOPT Version :8

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_956786.1 Gene:tmem68 / 393464 ZFINID:ZDB-GENE-040426-1267 Length:331 Species:Danio rerio

Alignment Length:310 Identity:157/311 (50%)
Similarity:213/311 (68%) Gaps:13/311 (4%)


  Fly    15 LSSYID-LDYSLWLYRFLTPLIVTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRV 78
            :..|:: |:|.:|::   |||:|.|:||.:.|.|:|:|.|.|.:||...|  :|....: |.|..
Zfish    34 IEDYLNFLEYLVWVF---TPLVVVFILPFLIVILLYLSILFLHVYKRKNQ--LREAYSN-NLWDG 92

  Fly    79 GRKIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIG 143
            .||.:|.:||.|..|:||||:.||:.:|.||||||||||||||:|.||..:.:::|:.|..:::.
Zfish    93 ARKTLATLWDGHGAIWHGYEIHGLDKIPDEGPALIVYYHGAIPVDYYYFLATVIIQKGRTCHSVA 157

  Fly   144 DRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGNLLAISPGGVYEAQFGDHYYELLWRNRVGFA 208
            |.||||:||:..:.|.|.|..|..:.||..||:|:||.||||||.||.|.|..|.|||..|.|||
Zfish   158 DHFLFKVPGFKLLLEVFSVIHGPQEECVRALRNGHLLGISPGGVREALFSDETYPLLWGKRKGFA 222

  Fly   209 KVAIEAKAPIIPCFTQNLREGFRQVGIFRTFFMRLYNKVRIPVYPIYGGFPVKFRTYLGKPIPYD 273
            :|||::|.|:||.||||||||||.:|..| ||..:|.:.|:||.||||||||||||:||.|||||
Zfish   223 QVAIDSKVPVIPMFTQNLREGFRSLGTLR-FFRWVYERFRLPVAPIYGGFPVKFRTFLGDPIPYD 286

  Fly   274 ENLTPQDLQIKVATAIEDLINQHQRLPGSILLALLDRLPTFRRRVRRKEE 323
            ..|...:|..||..|::.||::||::||:||.|||:|   |:|  ..||:
Zfish   287 PKLNAAELAEKVQQAVQALIDKHQKIPGNILRALLER---FQR--EHKED 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 121/224 (54%)
LPLAT_MGAT-like 90..298 CDD:153249 117/208 (56%)
tmem68NP_956786.1 PlsC 51..310 CDD:223282 138/263 (52%)
LPLAT_MGAT-like 104..311 CDD:153249 117/208 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C247420956
eggNOG 1 0.900 E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12440
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1558547at2759
OrthoFinder 1 1.000 FOG0006152
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133970
Panther 1 1.100 LDO PTHR22753
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.