DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and acl-13

DIOPT Version :8

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_502370.1 Gene:acl-13 / 184203 WormBaseID:WBGene00008581 Length:363 Species:Caenorhabditis elegans

Alignment Length:291 Identity:51/292 (17%)
Similarity:99/292 (34%) Gaps:100/292 (34%)


  Fly    34 LIVTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRVGR-KIVAAIWDAHARIYHGY 97
            ::..|:.|:||:...|.:..::......|:.:|:.:.      |.|. :.:..:     || .|.
 Worm    29 IVTAFICPIVFLCFFYTAAPIMLFSTEFRKFVMKIMA------RAGNLQFITCV-----RI-TGI 81

  Fly    98 EVI----GLENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLFKLPGWGTISE 158
            :|:    |||.:                     .:.|.||....|  .:.|.|:|.     |.::
 Worm    82 KVMMSGDGLERL---------------------TDCRALLLPNHL--GLFDHFIFM-----TAAD 118

  Fly   159 AFHVSPGTVQSCVSILRDGNLLAISPGGVYEAQFGDHYYELLWRNRVGFAKVAIEAKAPIIPCFT 223
            :|.|:  .|...:.::.  |:...||.|...:.:|:::.:          .|....:|..:....
 Worm   119 SFGVN--AVGRWIFVIY--NMWIYSPLGWLWSSYGNYFID----------SVPPHKRAQTLHSLR 169

  Fly   224 QNLREGFRQVGI---------FRTFFMRLYN-----KVRIP-----VYPIYGGF----------- 258
            ::....:.:|.:         .|.|.::..|     |..:|     .||..|..           
 Worm   170 RHFDRIYHEVDLRWLCLYPEGSRLFLIQKRNSEFEKKRGLPPLTNCAYPRLGAALSAIKVLGPDP 234

  Fly   259 --PVKFRTYLGKPIPY---------DENLTP 278
              |:|.....|.|:.|         |.|:.|
 Worm   235 NNPLKSNNGKGPPLEYLVDVTLGYPDGNILP 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 43/261 (16%)
LPLAT_MGAT-like 90..298 CDD:153249 42/235 (18%)
acl-13NP_502370.1 LPLAT 78..286 CDD:302626 41/232 (18%)
Acyltransf_C 279..>328 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.