DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and AGPAT1

DIOPT Version :8

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_005248862.1 Gene:AGPAT1 / 10554 HGNCID:324 Length:287 Species:Homo sapiens

Alignment Length:320 Identity:75/321 (23%)
Similarity:116/321 (36%) Gaps:100/321 (31%)


  Fly    19 IDLDYSLWLYRFLTPLIVTFLLPLV---------FVALIYISFLVLFIYKLHRQVIMRAVQGDRN 74
            :||....|:...|..|::.||||.:         |..:.:.:..:||:..|  .:.:.||:| ||
Human     5 MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVL--AIPVCAVRG-RN 66

  Fly    75 FWRVGRKIVAAIWDAHARIYHG--YEVIGLENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQRER 137
               |....:..:...|.:..:|  .||.|..:.|...|.::|..|.: .:|:..:          
Human    67 ---VENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQS-SLDLLGM---------- 117

  Fly   138 LIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGNLLAISPG------GVYEAQFGDHY 196
                                  ..|.||   .||.|.:...|.|.|.|      ||.   |.|  
Human   118 ----------------------MEVLPG---RCVPIAKRELLWAGSAGLACWLAGVI---FID-- 152

  Fly   197 YELLWRNRVGFAKVAIEAKAPIIPCFTQNLR-----EGFR----QVGIFRTFFMRLYNKVRIPVY 252
                 |.|.|.|...:...|..:  .||::|     ||.|    .:..|:.....|..:.::|:.
Human   153 -----RKRTGDAISVMSEVAQTL--LTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIV 210

  Fly   253 PI----YGGFPVK--FRTYLGK-------PIPYDENLTPQDLQIKVATAIEDLINQHQRL 299
            ||    |..|..|  .|...|:       |:| .|.|||.|:     .|:.|.: :|..|
Human   211 PIVMSSYQDFYCKKERRFTSGQCQVRVLPPVP-TEGLTPDDV-----PALADRV-RHSML 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 55/254 (22%)
LPLAT_MGAT-like 90..298 CDD:153249 55/238 (23%)
AGPAT1XP_005248862.1 PlsC 48..262 CDD:223282 64/275 (23%)
LPLAT_AGPAT-like 73..259 CDD:153251 54/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.