DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and lpcat1

DIOPT Version :8

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002933165.1 Gene:lpcat1 / 100487143 XenbaseID:XB-GENE-6048968 Length:535 Species:Xenopus tropicalis

Alignment Length:135 Identity:30/136 (22%)
Similarity:55/136 (40%) Gaps:28/136 (21%)


  Fly    36 VTFLLPLVF-VALIYISFLVLFIYKLHRQVIMRAVQGD----RNFWR-----VGRKIVAAIWDAH 90
            :.|:...|| :.|.:.:|::|..:.......|...:.|    .::||     :.:.|:..:|.|.
 Frog    46 ILFMTLTVFPIRLFFAAFMMLLAWPFAFIAAMGRTEKDLEKPLSWWRKVLDLLLKAIMRTMWFAG 110

  Fly    91 ARIYHGYEVIGLENVPQEGPALIV----YYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLFKLP 151
            .  :|...|.|.:.:|.|.|.|.:    .|..|||:.|...:..|..:.:            .:|
 Frog   111 G--FHWVTVKGQQALPAEAPILTLAPHSSYFDAIPVTMTMASIVMKAESK------------DIP 161

  Fly   152 GWGTI 156
            .|||:
 Frog   162 VWGTL 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 27/124 (22%)
LPLAT_MGAT-like 90..298 CDD:153249 17/72 (24%)
lpcat1XP_002933165.1 PlsC 56..309 CDD:223282 27/126 (21%)
LPLAT_LPCAT1-like 103..314 CDD:153253 19/79 (24%)
FRQ1 336..476 CDD:227455
EF-hand_8 431..482 CDD:290545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.