DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and lpcat2

DIOPT Version :8

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_012815924.1 Gene:lpcat2 / 100124943 XenbaseID:XB-GENE-946438 Length:569 Species:Xenopus tropicalis

Alignment Length:376 Identity:67/377 (18%)
Similarity:122/377 (32%) Gaps:137/377 (36%)


  Fly    38 FLLPL---VFVALIYISFLVLFIYKLHRQVIMRAVQGDRN-----FWRVGRKIVAAIWDAHARI- 93
            |||||   :|:.::.:|:||        ..|......::|     .||  ||:...:..:..|: 
 Frog    80 FLLPLRVILFMIVLLVSWLV--------AAIATCCCPEKNEKPLEGWR--RKVTQTLIGSLGRLL 134

  Fly    94 -----YHGYEVIGLENVPQEGPALIVYYHGAIPIDMYYLNSRM---LLQRERLIYTIGDRFLFKL 150
                 :| ..|.|....|.:.|.|:|..|.:....:..:.|.|   :.:.|.:          .:
 Frog   135 FFSMGFH-VRVKGKPATPSDAPILLVAPHSSFFDAIAVIVSGMPSSVSRAENI----------SV 188

  Fly   151 PGWGTISEAF------HVSPGTVQSCVSILRDGNLLAISPGGVYEAQFGDHYYELL------WRN 203
            |.:|.|..|.      .|.|.:.::.::.::.            .|..|..:.::|      ..|
 Frog   189 PIFGRILRALQPVLVSRVDPDSRKNTINEIKK------------RATSGGEWPQVLIFPEGTCTN 241

  Fly   204 R---VGFAKVAIEAKAPIIPCFTQ--NLR-------EGFRQVGIFRTFFMRLYNKVRIPVYPIYG 256
            |   :.|...|.....|:.|...:  |::       :||....:......::...|.:...|:|.
 Frog   242 RSCLISFKPGAFHPGVPVQPILLRYPNIQDTVTWTWQGFSVEKLLLLTLCQICTNVTVEFLPVYV 306

  Fly   257 ------------------------GFPVKFRTY-------------------------LGKPIPY 272
                                    |.||...||                         :.|.:..
 Frog   307 PSEEEKKDPFLYAHNVRHTMAQALGLPVTDHTYEDCRLMMTAGELTLPMETGLVEFTKISKKLNL 371

  Fly   273 DENLTPQDLQIKVATA---------IEDLINQHQRLPGSILL----ALLDR 310
            ..:...:.|::..:.|         ||:..| |.:||.|.:|    :|.||
 Frog   372 KWDSIKKQLEVFASIAGSCKGGRIGIEEFAN-HLKLPVSDVLRELFSLFDR 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 48/311 (15%)
LPLAT_MGAT-like 90..298 CDD:153249 45/299 (15%)
lpcat2XP_012815924.1 PlsC 84..>268 CDD:223282 38/217 (18%)
LPLAT_LPCAT1-like 132..343 CDD:153253 38/234 (16%)
FRQ1 359..509 CDD:227455 14/65 (22%)
EFh 412..474 CDD:238008 4/11 (36%)
EFh 449..504 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.